Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 820579..821413 | Replicon | chromosome |
| Accession | NZ_CP097367 | ||
| Organism | Escherichia coli strain AGR6128 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | M7747_RS04000 | Protein ID | WP_000854690.1 |
| Coordinates | 820579..820956 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | M7747_RS04005 | Protein ID | WP_001305076.1 |
| Coordinates | 821045..821413 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M7747_RS03970 (816959) | 816959..817129 | - | 171 | Protein_780 | IS110 family transposase | - |
| M7747_RS03975 (817600) | 817600..818493 | - | 894 | WP_001114681.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| M7747_RS03980 (818486) | 818486..818881 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| M7747_RS03985 (818950) | 818950..819795 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| M7747_RS03990 (819880) | 819880..820077 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| M7747_RS03995 (820094) | 820094..820582 | - | 489 | WP_000761699.1 | DUF5983 family protein | - |
| M7747_RS04000 (820579) | 820579..820956 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| M7747_RS04005 (821045) | 821045..821413 | - | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M7747_RS04010 (821463) | 821463..822107 | - | 645 | WP_000094916.1 | hypothetical protein | - |
| M7747_RS04015 (822126) | 822126..822347 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| M7747_RS04020 (822410) | 822410..822886 | - | 477 | WP_001186726.1 | RadC family protein | - |
| M7747_RS04025 (822902) | 822902..823387 | - | 486 | WP_000849565.1 | antirestriction protein | - |
| M7747_RS04030 (823442) | 823442..824260 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| M7747_RS04035 (824361) | 824361..824594 | - | 234 | WP_000902034.1 | DUF905 family protein | - |
| M7747_RS04040 (824673) | 824673..825128 | - | 456 | WP_000581502.1 | IrmA family protein | - |
| M7747_RS04045 (825204) | 825204..826331 | - | 1128 | Protein_795 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat | 800622..869625 | 69003 | |
| - | flank | IS/Tn | - | - | 816959..817114 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T245291 WP_000854690.1 NZ_CP097367:c820956-820579 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT245291 WP_001305076.1 NZ_CP097367:c821413-821045 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|