245291

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 820579..821413 Replicon chromosome
Accession NZ_CP097367
Organism Escherichia coli strain AGR6128

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag M7747_RS04000 Protein ID WP_000854690.1
Coordinates 820579..820956 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag M7747_RS04005 Protein ID WP_001305076.1
Coordinates 821045..821413 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7747_RS03970 (816959) 816959..817129 - 171 Protein_780 IS110 family transposase -
M7747_RS03975 (817600) 817600..818493 - 894 WP_001114681.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M7747_RS03980 (818486) 818486..818881 - 396 WP_000208383.1 DUF6088 family protein -
M7747_RS03985 (818950) 818950..819795 - 846 WP_001529401.1 DUF4942 domain-containing protein -
M7747_RS03990 (819880) 819880..820077 - 198 WP_000839293.1 DUF957 domain-containing protein -
M7747_RS03995 (820094) 820094..820582 - 489 WP_000761699.1 DUF5983 family protein -
M7747_RS04000 (820579) 820579..820956 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
M7747_RS04005 (821045) 821045..821413 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M7747_RS04010 (821463) 821463..822107 - 645 WP_000094916.1 hypothetical protein -
M7747_RS04015 (822126) 822126..822347 - 222 WP_000692329.1 DUF987 domain-containing protein -
M7747_RS04020 (822410) 822410..822886 - 477 WP_001186726.1 RadC family protein -
M7747_RS04025 (822902) 822902..823387 - 486 WP_000849565.1 antirestriction protein -
M7747_RS04030 (823442) 823442..824260 - 819 WP_001234620.1 DUF932 domain-containing protein -
M7747_RS04035 (824361) 824361..824594 - 234 WP_000902034.1 DUF905 family protein -
M7747_RS04040 (824673) 824673..825128 - 456 WP_000581502.1 IrmA family protein -
M7747_RS04045 (825204) 825204..826331 - 1128 Protein_795 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 800622..869625 69003
- flank IS/Tn - - 816959..817114 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T245291 WP_000854690.1 NZ_CP097367:c820956-820579 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT245291 WP_001305076.1 NZ_CP097367:c821413-821045 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References