Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4031864..4032414 Replicon chromosome
Accession NZ_CP097360
Organism Escherichia coli strain AGR4587

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag M7749_RS19660 Protein ID WP_001160966.1
Coordinates 4031864..4032178 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag M7749_RS19665 Protein ID WP_000125566.1
Coordinates 4032181..4032414 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M7749_RS19635 (4027539) 4027539..4028825 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M7749_RS19640 (4028825) 4028825..4029814 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M7749_RS19645 (4029811) 4029811..4030632 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M7749_RS19650 (4030635) 4030635..4031012 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M7749_RS19655 (4031019) 4031019..4031867 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M7749_RS19660 (4031864) 4031864..4032178 - 315 WP_001160966.1 CcdB family protein Toxin
M7749_RS19665 (4032181) 4032181..4032414 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M7749_RS19670 (4032500) 4032500..4032979 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M7749_RS19675 (4033171) 4033171..4035033 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
M7749_RS19680 (4035026) 4035026..4035556 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M7749_RS19685 (4035664) 4035664..4036995 - 1332 WP_001183207.1 MFS transporter -
M7749_RS19690 (4037054) 4037054..4037341 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T245282 WP_001160966.1 NZ_CP097360:c4032178-4031864 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT245282 WP_000125566.1 NZ_CP097360:c4032414-4032181 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References