Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3918893..3919530 | Replicon | chromosome |
Accession | NZ_CP097359 | ||
Organism | Bacillus velezensis strain H208 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | M5C55_RS19360 | Protein ID | WP_003156187.1 |
Coordinates | 3919180..3919530 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | M5C55_RS19355 | Protein ID | WP_003156188.1 |
Coordinates | 3918893..3919174 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5C55_RS19335 (M5C55_19335) | 3915258..3915857 | - | 600 | WP_032872997.1 | rhomboid family intramembrane serine protease | - |
M5C55_RS19340 (M5C55_19340) | 3915950..3916315 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
M5C55_RS19345 (M5C55_19345) | 3916480..3917487 | + | 1008 | WP_032872999.1 | outer membrane lipoprotein carrier protein LolA | - |
M5C55_RS19350 (M5C55_19350) | 3917604..3918773 | + | 1170 | WP_032873001.1 | alanine racemase | - |
M5C55_RS19355 (M5C55_19355) | 3918893..3919174 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
M5C55_RS19360 (M5C55_19360) | 3919180..3919530 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
M5C55_RS19365 (M5C55_19365) | 3919648..3920469 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
M5C55_RS19370 (M5C55_19370) | 3920474..3920839 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
M5C55_RS19375 (M5C55_19375) | 3920842..3921243 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
M5C55_RS19380 (M5C55_19380) | 3921255..3922262 | + | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
M5C55_RS19385 (M5C55_19385) | 3922326..3922655 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
M5C55_RS19390 (M5C55_19390) | 3922652..3923134 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
M5C55_RS19395 (M5C55_19395) | 3923100..3923888 | + | 789 | WP_032873003.1 | RNA polymerase sigma factor SigB | - |
M5C55_RS19400 (M5C55_19400) | 3923888..3924490 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T245264 WP_003156187.1 NZ_CP097359:3919180-3919530 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|