Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 740341..741258 | Replicon | chromosome |
Accession | NZ_CP097359 | ||
Organism | Bacillus velezensis strain H208 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | M5C55_RS03890 | Protein ID | WP_007407256.1 |
Coordinates | 740512..741258 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | M5C55_RS03885 | Protein ID | WP_003154807.1 |
Coordinates | 740341..740511 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5C55_RS03845 (M5C55_03845) | 735574..737196 | + | 1623 | WP_032874601.1 | pyocin knob domain-containing protein | - |
M5C55_RS03850 (M5C55_03850) | 737209..737580 | + | 372 | WP_032874603.1 | XkdW family protein | - |
M5C55_RS03855 (M5C55_03855) | 737585..737782 | + | 198 | WP_032874605.1 | XkdX family protein | - |
M5C55_RS03860 (M5C55_03860) | 737839..738600 | + | 762 | WP_032874607.1 | hypothetical protein | - |
M5C55_RS03865 (M5C55_03865) | 738652..738915 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
M5C55_RS03870 (M5C55_03870) | 738929..739192 | + | 264 | WP_003154813.1 | phage holin | - |
M5C55_RS03875 (M5C55_03875) | 739206..740084 | + | 879 | WP_032874609.1 | N-acetylmuramoyl-L-alanine amidase | - |
M5C55_RS03880 (M5C55_03880) | 740119..740244 | - | 126 | WP_003154809.1 | hypothetical protein | - |
M5C55_RS03885 (M5C55_03885) | 740341..740511 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
M5C55_RS03890 (M5C55_03890) | 740512..741258 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M5C55_RS03895 (M5C55_03895) | 741363..742361 | - | 999 | WP_032874611.1 | inorganic phosphate transporter | - |
M5C55_RS03900 (M5C55_03900) | 742374..742991 | - | 618 | WP_032874614.1 | DUF47 domain-containing protein | - |
M5C55_RS03905 (M5C55_03905) | 743277..744593 | - | 1317 | WP_032874616.1 | amino acid permease | - |
M5C55_RS03910 (M5C55_03910) | 744915..745865 | + | 951 | WP_032874618.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T245263 WP_007407256.1 NZ_CP097359:c741258-740512 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|