Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
| Location | 1853357..1853904 | Replicon | chromosome |
| Accession | NZ_CP097355 | ||
| Organism | Vibrio parahaemolyticus strain 16-VB00198 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M5598_RS08565 | Protein ID | WP_029831603.1 |
| Coordinates | 1853357..1853659 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M5598_RS08570 | Protein ID | WP_029831605.1 |
| Coordinates | 1853647..1853904 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5598_RS08540 (M5598_08535) | 1849169..1850620 | + | 1452 | WP_020840740.1 | phospholipase D family protein | - |
| M5598_RS08545 (M5598_08540) | 1850679..1852385 | - | 1707 | WP_031817767.1 | autotransporter assembly complex family protein | - |
| M5598_RS08550 (M5598_08545) | 1852460..1852660 | + | 201 | WP_031817768.1 | hypothetical protein | - |
| M5598_RS08555 (M5598_08550) | 1852783..1852881 | - | 99 | Protein_1590 | DUF3265 domain-containing protein | - |
| M5598_RS08560 | 1852871..1852993 | - | 123 | WP_257213318.1 | hypothetical protein | - |
| M5598_RS08565 (M5598_08560) | 1853357..1853659 | - | 303 | WP_029831603.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5598_RS08570 (M5598_08565) | 1853647..1853904 | - | 258 | WP_029831605.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5598_RS08575 (M5598_08570) | 1854042..1854407 | - | 366 | WP_031817771.1 | T6SS amidase immunity protein Tai4 family protein | - |
| M5598_RS08580 (M5598_08575) | 1854389..1854697 | - | 309 | WP_031817772.1 | hypothetical protein | - |
| M5598_RS08585 (M5598_08580) | 1854946..1855482 | - | 537 | WP_031817773.1 | nucleotidyltransferase family protein | - |
| M5598_RS08590 (M5598_08585) | 1855508..1855630 | - | 123 | WP_079879775.1 | DUF3265 domain-containing protein | - |
| M5598_RS08595 (M5598_08590) | 1855631..1856152 | - | 522 | WP_068864723.1 | GNAT family N-acetyltransferase | - |
| M5598_RS08600 (M5598_08595) | 1856721..1856843 | - | 123 | WP_072599483.1 | DUF3265 domain-containing protein | - |
| M5598_RS08605 (M5598_08600) | 1856906..1857247 | - | 342 | WP_031818231.1 | cupin domain-containing protein | - |
| M5598_RS08610 (M5598_08605) | 1857307..1857474 | - | 168 | WP_001883086.1 | DUF3265 domain-containing protein | - |
| M5598_RS08615 (M5598_08610) | 1858058..1858219 | + | 162 | WP_228084798.1 | hypothetical protein | - |
| M5598_RS08620 (M5598_08615) | 1858329..1858448 | - | 120 | WP_079751600.1 | DUF3265 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integron | - | - | 1852460..1857861 | 5401 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11689.56 Da Isoelectric Point: 4.7146
>T245260 WP_029831603.1 NZ_CP097355:c1853659-1853357 [Vibrio parahaemolyticus]
MAEIIWTEPALSDLDDIAEYIALENFVAAKQLVQTIFAKVERLETFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
MAEIIWTEPALSDLDDIAEYIALENFVAAKQLVQTIFAKVERLETFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|