Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2366662..2367640 | Replicon | chromosome |
Accession | NZ_CP097351 | ||
Organism | Bacillus cereus strain DQ01 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | M6D84_RS12160 | Protein ID | WP_000624974.1 |
Coordinates | 2366662..2367399 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | W8YZL5 |
Locus tag | M6D84_RS12165 | Protein ID | WP_000237818.1 |
Coordinates | 2367512..2367640 (+) | Length | 43 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M6D84_RS12140 (M6D84_12140) | 2362304..2363086 | + | 783 | WP_016512842.1 | class I SAM-dependent methyltransferase | - |
M6D84_RS12145 (M6D84_12145) | 2363244..2364920 | - | 1677 | WP_048558851.1 | alpha-keto acid decarboxylase family protein | - |
M6D84_RS12150 (M6D84_12150) | 2365037..2365519 | + | 483 | WP_000191887.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
M6D84_RS12155 (M6D84_12155) | 2365686..2366423 | + | 738 | WP_048558852.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
M6D84_RS12160 (M6D84_12160) | 2366662..2367399 | + | 738 | WP_000624974.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
M6D84_RS12165 (M6D84_12165) | 2367512..2367640 | + | 129 | WP_000237818.1 | hypothetical protein | Antitoxin |
M6D84_RS12170 (M6D84_12170) | 2367713..2367889 | + | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
M6D84_RS12175 (M6D84_12175) | 2367909..2368298 | - | 390 | WP_048558853.1 | YxeA family protein | - |
M6D84_RS12180 (M6D84_12180) | 2368510..2369979 | + | 1470 | WP_000287547.1 | beta-Ala-His dipeptidase | - |
M6D84_RS12185 (M6D84_12185) | 2370225..2371034 | + | 810 | WP_000664543.1 | papain-like cysteine protease family protein | - |
M6D84_RS12190 (M6D84_12190) | 2371060..2371662 | + | 603 | WP_000517268.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28375.07 Da Isoelectric Point: 8.3170
>T245259 WP_000624974.1 NZ_CP097351:2366662-2367399 [Bacillus cereus]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTHWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFTDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPSVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIIIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTHWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFTDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPSVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIIIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|