Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 3897096..3897732 | Replicon | chromosome |
| Accession | NZ_CP097349 | ||
| Organism | Cytobacillus pseudoceanisediminis strain BNO1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | W7KPR3 |
| Locus tag | M5V91_RS21035 | Protein ID | WP_009336311.1 |
| Coordinates | 3897096..3897446 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A160MHA2 |
| Locus tag | M5V91_RS21040 | Protein ID | WP_026041666.1 |
| Coordinates | 3897451..3897732 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5V91_RS21000 (M5V91_20785) | 3892460..3893254 | - | 795 | WP_251175626.1 | RNA polymerase sigma factor SigB | - |
| M5V91_RS21005 (M5V91_20790) | 3893232..3893704 | - | 473 | Protein_4124 | anti-sigma B factor RsbW | - |
| M5V91_RS21010 (M5V91_20795) | 3893701..3894033 | - | 333 | WP_009336305.1 | anti-sigma factor antagonist | - |
| M5V91_RS21015 (M5V91_20800) | 3894094..3895104 | - | 1011 | WP_019381250.1 | PP2C family protein-serine/threonine phosphatase | - |
| M5V91_RS21020 (M5V91_20805) | 3895116..3895517 | - | 402 | WP_009336308.1 | anti-sigma regulatory factor | - |
| M5V91_RS21025 (M5V91_20810) | 3895522..3895884 | - | 363 | WP_009336309.1 | STAS domain-containing protein | - |
| M5V91_RS21030 (M5V91_20815) | 3895881..3896714 | - | 834 | WP_009336310.1 | RsbT co-antagonist protein RsbRA | - |
| M5V91_RS21035 (M5V91_20820) | 3897096..3897446 | - | 351 | WP_009336311.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| M5V91_RS21040 (M5V91_20825) | 3897451..3897732 | - | 282 | WP_026041666.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| M5V91_RS21045 (M5V91_20830) | 3898108..3899379 | - | 1272 | WP_284521489.1 | alanine racemase | - |
| M5V91_RS21050 (M5V91_20835) | 3899434..3900447 | - | 1014 | WP_019381248.1 | outer membrane lipoprotein carrier protein LolA | - |
| M5V91_RS21055 (M5V91_20840) | 3900591..3900944 | - | 354 | WP_009336315.1 | holo-ACP synthase | - |
| M5V91_RS21060 (M5V91_20845) | 3901109..3901834 | + | 726 | WP_009336316.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13006.03 Da Isoelectric Point: 4.8998
>T245257 WP_009336311.1 NZ_CP097349:c3897446-3897096 [Cytobacillus pseudoceanisediminis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEAVQISLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEAVQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A169FD46 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A160MHA2 |