Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 110903..111546 Replicon plasmid p4_va18651
Accession NZ_CP097346
Organism Enterobacter hormaechei subsp. xiangfangensis strain va18651

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag M5K26_RS26070 Protein ID WP_058672500.1
Coordinates 110903..111319 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag M5K26_RS26075 Protein ID WP_058672491.1
Coordinates 111316..111546 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5K26_RS26045 (106386) 106386..106724 - 339 WP_007374386.1 carboxymuconolactone decarboxylase family protein -
M5K26_RS26050 (106741) 106741..107310 - 570 WP_045334638.1 TetR/AcrR family transcriptional regulator -
M5K26_RS26055 (107494) 107494..108051 - 558 WP_007374384.1 OsmC family protein -
M5K26_RS26060 (108260) 108260..109282 - 1023 WP_045334637.1 helicase UvrD -
M5K26_RS26065 (109267) 109267..110829 - 1563 WP_045334636.1 AAA family ATPase -
M5K26_RS26070 (110903) 110903..111319 - 417 WP_058672500.1 type II toxin-antitoxin system VapC family toxin Toxin
M5K26_RS26075 (111316) 111316..111546 - 231 WP_058672491.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5K26_RS26080 (111933) 111933..112286 + 354 WP_269147465.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
M5K26_RS26085 (112336) 112336..112698 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
M5K26_RS26090 (112716) 112716..114467 + 1752 WP_045334630.1 arsenite efflux transporter ATPase subunit ArsA -
M5K26_RS26095 (114515) 114515..115804 + 1290 WP_004152098.1 arsenite efflux transporter membrane subunit ArsB -
M5K26_RS26100 (115817) 115817..116242 + 426 WP_045334628.1 glutaredoxin-dependent arsenate reductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..154302 154302


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15161.57 Da        Isoelectric Point: 7.2452

>T245256 WP_058672500.1 NZ_CP097346:c111319-110903 [Enterobacter hormaechei subsp. xiangfangensis]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRD
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8650.75 Da        Isoelectric Point: 4.5881

>AT245256 WP_058672491.1 NZ_CP097346:c111546-111316 [Enterobacter hormaechei subsp. xiangfangensis]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAERGDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References