Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 4615..5258 Replicon plasmid p4_va18651
Accession NZ_CP097346
Organism Enterobacter hormaechei subsp. xiangfangensis strain va18651

Toxin (Protein)


Gene name vagD Uniprot ID A0A5P6KDG5
Locus tag M5K26_RS25485 Protein ID WP_021312768.1
Coordinates 4615..5031 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag M5K26_RS25490 Protein ID WP_058672491.1
Coordinates 5028..5258 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5K26_RS25465 (487) 487..1797 - 1311 WP_058672494.1 MFS transporter -
M5K26_RS25470 (1926) 1926..2834 + 909 WP_058672493.1 LysR family transcriptional regulator -
M5K26_RS25475 (3003) 3003..3434 - 432 WP_047732374.1 nuclear transport factor 2 family protein -
M5K26_RS25480 (3615) 3615..4517 + 903 WP_058672492.1 helix-turn-helix transcriptional regulator -
M5K26_RS25485 (4615) 4615..5031 - 417 WP_021312768.1 type II toxin-antitoxin system VapC family toxin Toxin
M5K26_RS25490 (5028) 5028..5258 - 231 WP_058672491.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M5K26_RS25495 (5853) 5853..6182 + 330 WP_045334596.1 hypothetical protein -
M5K26_RS25500 (6232) 6232..6939 + 708 WP_052685521.1 hypothetical protein -
M5K26_RS25505 (6981) 6981..7724 + 744 WP_047366186.1 site-specific integrase -
M5K26_RS25510 (7915) 7915..8169 + 255 Protein_10 site-specific integrase -
M5K26_RS25515 (8416) 8416..9426 - 1011 WP_045334592.1 RepB family plasmid replication initiator protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..154302 154302


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15175.60 Da        Isoelectric Point: 7.2452

>T245254 WP_021312768.1 NZ_CP097346:c5031-4615 [Enterobacter hormaechei subsp. xiangfangensis]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPDLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8650.75 Da        Isoelectric Point: 4.5881

>AT245254 WP_058672491.1 NZ_CP097346:c5258-5028 [Enterobacter hormaechei subsp. xiangfangensis]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAERGDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5P6KDG5

Antitoxin

Source ID Structure

References