Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 221565..222091 | Replicon | plasmid p1_va18651 |
| Accession | NZ_CP097343 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain va18651 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | M5K26_RS24080 | Protein ID | WP_000323025.1 |
| Coordinates | 221565..221852 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | M5K26_RS24085 | Protein ID | WP_000534858.1 |
| Coordinates | 221852..222091 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5K26_RS24045 (M5K26_24020) | 217135..217311 | - | 177 | WP_001371930.1 | hypothetical protein | - |
| M5K26_RS24050 (M5K26_24025) | 217822..218766 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
| M5K26_RS24055 (M5K26_24030) | 218862..219464 | + | 603 | WP_012695474.1 | hypothetical protein | - |
| M5K26_RS24060 (M5K26_24035) | 219524..219874 | + | 351 | WP_000743059.1 | hypothetical protein | - |
| M5K26_RS24065 (M5K26_24040) | 219921..220124 | + | 204 | WP_001015183.1 | hypothetical protein | - |
| M5K26_RS24070 (M5K26_24045) | 220406..220726 | + | 321 | WP_000332796.1 | hypothetical protein | - |
| M5K26_RS24075 (M5K26_24050) | 221339..221464 | - | 126 | WP_229020258.1 | DUF5431 family protein | - |
| M5K26_RS24080 (M5K26_24055) | 221565..221852 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M5K26_RS24085 (M5K26_24060) | 221852..222091 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| M5K26_RS24090 (M5K26_24065) | 222116..222220 | + | 105 | Protein_234 | protein YdfV | - |
| M5K26_RS24095 (M5K26_24070) | 222354..223277 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
| M5K26_RS24100 (M5K26_24075) | 223477..224049 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| M5K26_RS24105 (M5K26_24080) | 224525..225763 | - | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / catA2 / tet(D) / aadA2 / qacE / sul1 / qnrA1 / dfrA19 / aph(3'')-Ib / aph(6)-Id / mcr-9 / aac(6')-IIc / ere(A) / sul2 / blaSHV-12 | - | 1..307415 | 307415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T245253 WP_000323025.1 NZ_CP097343:c221852-221565 [Enterobacter hormaechei subsp. xiangfangensis]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|