Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3870010..3870667 | Replicon | chromosome |
| Accession | NZ_CP097342 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain va18651 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A7T9SH06 |
| Locus tag | M5K26_RS18545 | Protein ID | WP_023295382.1 |
| Coordinates | 3870010..3870420 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | M5K26_RS18550 | Protein ID | WP_003863437.1 |
| Coordinates | 3870401..3870667 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5K26_RS18525 (M5K26_18500) | 3866009..3867742 | - | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| M5K26_RS18530 (M5K26_18505) | 3867748..3868461 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5K26_RS18535 (M5K26_18510) | 3868490..3869386 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| M5K26_RS18540 (M5K26_18515) | 3869487..3870008 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| M5K26_RS18545 (M5K26_18520) | 3870010..3870420 | - | 411 | WP_023295382.1 | protein YgfX | Toxin |
| M5K26_RS18550 (M5K26_18525) | 3870401..3870667 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| M5K26_RS18555 (M5K26_18530) | 3870962..3871942 | + | 981 | WP_022649306.1 | tRNA-modifying protein YgfZ | - |
| M5K26_RS18560 (M5K26_18535) | 3872054..3872713 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| M5K26_RS18565 (M5K26_18540) | 3872980..3873711 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| M5K26_RS18570 (M5K26_18545) | 3873828..3875261 | + | 1434 | WP_045910760.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16291.18 Da Isoelectric Point: 11.4775
>T245249 WP_023295382.1 NZ_CP097342:c3870420-3870010 [Enterobacter hormaechei subsp. xiangfangensis]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGAPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGAPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7T9SH06 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |