Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2406097..2406836 | Replicon | chromosome |
| Accession | NZ_CP097342 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain va18651 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
| Locus tag | M5K26_RS11685 | Protein ID | WP_003857133.1 |
| Coordinates | 2406097..2406582 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A837FCR9 |
| Locus tag | M5K26_RS11690 | Protein ID | WP_003857131.1 |
| Coordinates | 2406570..2406836 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5K26_RS11660 (M5K26_11650) | 2401604..2402029 | - | 426 | WP_000065802.1 | glutaredoxin-dependent arsenate reductase | - |
| M5K26_RS11665 (M5K26_11655) | 2402042..2403331 | - | 1290 | WP_000922628.1 | arsenic transporter | - |
| M5K26_RS11670 (M5K26_11660) | 2403377..2403697 | - | 321 | WP_000941305.1 | transcriptional regulator | - |
| M5K26_RS11675 (M5K26_11665) | 2403784..2404488 | + | 705 | WP_000130816.1 | arsenical resistance protein ArsH | - |
| M5K26_RS11680 (M5K26_11670) | 2404521..2405924 | - | 1404 | WP_000125668.1 | ISNCY family transposase | - |
| M5K26_RS11685 (M5K26_11675) | 2406097..2406582 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
| M5K26_RS11690 (M5K26_11680) | 2406570..2406836 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
| M5K26_RS11695 (M5K26_11685) | 2406900..2407829 | - | 930 | WP_045911831.1 | LysR family transcriptional regulator | - |
| M5K26_RS11700 (M5K26_11690) | 2407959..2409341 | + | 1383 | WP_045911739.1 | MFS transporter | - |
| M5K26_RS11705 (M5K26_11695) | 2409363..2410358 | - | 996 | WP_015570513.1 | DUF2891 domain-containing protein | - |
| M5K26_RS11710 (M5K26_11700) | 2410368..2411354 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2404521..2405924 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T245241 WP_003857133.1 NZ_CP097342:c2406582-2406097 [Enterobacter hormaechei subsp. xiangfangensis]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3L9PBP9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FCR9 |