Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1121809..1122429 Replicon chromosome
Accession NZ_CP097342
Organism Enterobacter hormaechei subsp. xiangfangensis strain va18651

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag M5K26_RS05350 Protein ID WP_015571250.1
Coordinates 1121809..1122027 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag M5K26_RS05355 Protein ID WP_006809850.1
Coordinates 1122055..1122429 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5K26_RS05320 (M5K26_05320) 1117821..1118081 + 261 WP_015571255.1 type B 50S ribosomal protein L31 -
M5K26_RS05325 (M5K26_05325) 1118084..1118224 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
M5K26_RS05330 (M5K26_05330) 1118221..1118931 - 711 WP_032670463.1 GNAT family protein -
M5K26_RS05335 (M5K26_05335) 1119033..1120493 + 1461 WP_045911102.1 PLP-dependent aminotransferase family protein -
M5K26_RS05340 (M5K26_05340) 1120465..1120932 - 468 WP_023296041.1 YlaC family protein -
M5K26_RS05345 (M5K26_05345) 1121049..1121600 - 552 WP_015571251.1 maltose O-acetyltransferase -
M5K26_RS05350 (M5K26_05350) 1121809..1122027 - 219 WP_015571250.1 HHA domain-containing protein Toxin
M5K26_RS05355 (M5K26_05355) 1122055..1122429 - 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
M5K26_RS05360 (M5K26_05360) 1122941..1126087 - 3147 WP_015571248.1 multidrug efflux RND transporter permease subunit AcrB -
M5K26_RS05365 (M5K26_05365) 1126110..1127303 - 1194 WP_017694395.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T245239 WP_015571250.1 NZ_CP097342:c1122027-1121809 [Enterobacter hormaechei subsp. xiangfangensis]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT245239 WP_006809850.1 NZ_CP097342:c1122429-1122055 [Enterobacter hormaechei subsp. xiangfangensis]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References