Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 807018..807619 | Replicon | chromosome |
| Accession | NZ_CP097340 | ||
| Organism | Mannheimia haemolytica strain B-31 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M3703_RS04225 | Protein ID | WP_249762741.1 |
| Coordinates | 807018..807326 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M3703_RS04230 | Protein ID | WP_044428321.1 |
| Coordinates | 807323..807619 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3703_RS04200 (M3703_04200) | 802164..802844 | - | 681 | WP_249762587.1 | DUF6037 family protein | - |
| M3703_RS04205 (M3703_04205) | 802974..803168 | + | 195 | WP_249762588.1 | hypothetical protein | - |
| M3703_RS04210 (M3703_04210) | 803171..805222 | + | 2052 | WP_249762589.1 | DNA topoisomerase III | - |
| M3703_RS04215 (M3703_04215) | 805275..805472 | + | 198 | WP_249762590.1 | hypothetical protein | - |
| M3703_RS04220 (M3703_04220) | 805556..806596 | + | 1041 | WP_249762565.1 | IS481 family transposase | - |
| M3703_RS04225 (M3703_04225) | 807018..807326 | - | 309 | WP_249762741.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| M3703_RS04230 (M3703_04230) | 807323..807619 | - | 297 | WP_044428321.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M3703_RS04235 (M3703_04235) | 807951..808295 | + | 345 | WP_249762591.1 | hypothetical protein | - |
| M3703_RS04240 (M3703_04240) | 808761..809165 | + | 405 | Protein_801 | STY4534 family ICE replication protein | - |
| M3703_RS04245 (M3703_04245) | 809435..809842 | + | 408 | WP_249762592.1 | heme utilization protein | - |
| M3703_RS04250 (M3703_04250) | 809940..810290 | + | 351 | WP_249762340.1 | hypothetical protein | - |
| M3703_RS04255 (M3703_04255) | 810381..810746 | + | 366 | WP_044428312.1 | hypothetical protein | - |
| M3703_RS04260 (M3703_04260) | 810825..811310 | + | 486 | WP_249762593.1 | DNA repair protein RadC | - |
| M3703_RS04265 (M3703_04265) | 811312..811674 | + | 363 | WP_044428316.1 | hypothetical protein | - |
| M3703_RS04270 (M3703_04270) | 811781..812017 | + | 237 | WP_249762594.1 | hypothetical protein | - |
| M3703_RS04275 (M3703_04275) | 812302..812538 | + | 237 | WP_249762595.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 773244..835568 | 62324 | |
| - | flank | IS/Tn | - | - | 805556..806596 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11867.67 Da Isoelectric Point: 7.9365
>T245233 WP_249762741.1 NZ_CP097340:c807326-807018 [Mannheimia haemolytica]
IMESKPLKVSYSKQFVRDLTDLAKRHPNVLIGTKYITAIHCLLNRLPLPEGYQDHALSGEWKGYRDCHIQGDLVLIYQYV
IHDEFDELKFARLNTHSQTALK
IMESKPLKVSYSKQFVRDLTDLAKRHPNVLIGTKYITAIHCLLNRLPLPEGYQDHALSGEWKGYRDCHIQGDLVLIYQYV
IHDEFDELKFARLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|