Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 1760407..1761057 | Replicon | chromosome |
Accession | NZ_CP097339 | ||
Organism | Mannheimia haemolytica strain H-5106 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A547EDJ6 |
Locus tag | M3710_RS08715 | Protein ID | WP_006249411.1 |
Coordinates | 1760407..1760796 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A547EDM1 |
Locus tag | M3710_RS08720 | Protein ID | WP_006249412.1 |
Coordinates | 1760797..1761057 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3710_RS08670 (M3710_08670) | 1755886..1756695 | - | 810 | WP_006250123.1 | metal ABC transporter permease | - |
M3710_RS08675 (M3710_08675) | 1756688..1757548 | - | 861 | WP_006250124.1 | metal ABC transporter permease | - |
M3710_RS08680 (M3710_08680) | 1757622..1758407 | - | 786 | WP_006251768.1 | hypothetical protein | - |
M3710_RS08710 (M3710_08710) | 1759149..1760387 | - | 1239 | WP_006253630.1 | peptidase T | - |
M3710_RS08715 (M3710_08715) | 1760407..1760796 | - | 390 | WP_006249411.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3710_RS08720 (M3710_08720) | 1760797..1761057 | - | 261 | WP_006249412.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
M3710_RS08725 (M3710_08725) | 1761173..1761385 | - | 213 | WP_006251765.1 | BrnA antitoxin family protein | - |
M3710_RS08730 (M3710_08730) | 1761386..1761673 | - | 288 | WP_006251764.1 | BrnT family toxin | - |
M3710_RS08735 (M3710_08735) | 1761836..1765369 | - | 3534 | WP_006253629.1 | transcription-repair coupling factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14633.91 Da Isoelectric Point: 7.1041
>T245228 WP_006249411.1 NZ_CP097339:c1760796-1760407 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A547EDJ6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A547EDM1 |