Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 799401..800041 Replicon chromosome
Accession NZ_CP097339
Organism Mannheimia haemolytica strain H-5106

Toxin (Protein)


Gene name hicA Uniprot ID A0A378NFX7
Locus tag M3710_RS04035 Protein ID WP_006250075.1
Coordinates 799859..800041 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A378NFW9
Locus tag M3710_RS04030 Protein ID WP_006250074.1
Coordinates 799401..799820 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3710_RS04010 (M3710_04010) 794758..795564 + 807 WP_006248821.1 tryptophan synthase subunit alpha -
M3710_RS04015 (M3710_04015) 795614..797020 + 1407 WP_006253513.1 YdgA family protein -
M3710_RS04020 (M3710_04020) 797087..798127 - 1041 WP_015587044.1 IS481 family transposase -
M3710_RS04025 (M3710_04025) 798421..799065 - 645 WP_006253274.1 tyrosine-type recombinase/integrase -
M3710_RS04030 (M3710_04030) 799401..799820 - 420 WP_006250074.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M3710_RS04035 (M3710_04035) 799859..800041 - 183 WP_006250075.1 type II toxin-antitoxin system HicA family toxin Toxin
M3710_RS04040 (M3710_04040) 800173..800670 - 498 WP_021279966.1 hypothetical protein -
M3710_RS04045 (M3710_04045) 800663..801043 - 381 WP_006248823.1 hypothetical protein -
M3710_RS04050 (M3710_04050) 801118..801801 - 684 WP_006248824.1 S24 family peptidase -
M3710_RS04055 (M3710_04055) 801932..802132 + 201 WP_006248825.1 YdaS family helix-turn-helix protein -
M3710_RS04060 (M3710_04060) 802153..803220 + 1068 WP_249762250.1 phage tail protein -
M3710_RS04065 (M3710_04065) 803230..803388 + 159 WP_006247809.1 hypothetical protein -
M3710_RS04070 (M3710_04070) 803397..803696 - 300 WP_006247810.1 XRE family transcriptional regulator -
M3710_RS04075 (M3710_04075) 803668..804057 - 390 WP_015484247.1 type II toxin-antitoxin system RelE/ParE family toxin -
M3710_RS04080 (M3710_04080) 804201..804494 + 294 WP_006247812.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 797087..798127 1040


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-96)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6933.03 Da        Isoelectric Point: 10.3446

>T245226 WP_006250075.1 NZ_CP097339:c800041-799859 [Mannheimia haemolytica]
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK

Download         Length: 183 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15938.30 Da        Isoelectric Point: 4.6963

>AT245226 WP_006250074.1 NZ_CP097339:c799820-799401 [Mannheimia haemolytica]
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQHFTILPH

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A378NFX7

Antitoxin

Source ID Structure
AlphaFold DB A0A378NFW9

References