Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 1100019..1100659 Replicon chromosome
Accession NZ_CP097338
Organism Mannheimia haemolytica strain P1148

Toxin (Protein)


Gene name hicA Uniprot ID A0A378NFX7
Locus tag M3708_RS05620 Protein ID WP_006250075.1
Coordinates 1100477..1100659 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A378NFW9
Locus tag M3708_RS05615 Protein ID WP_006250074.1
Coordinates 1100019..1100438 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3708_RS05595 (M3708_05595) 1095566..1096372 + 807 WP_006248821.1 tryptophan synthase subunit alpha -
M3708_RS05600 (M3708_05600) 1096422..1097828 + 1407 WP_006253513.1 YdgA family protein -
M3708_RS05605 (M3708_05605) 1097895..1098901 - 1007 Protein_1075 IS481 family transposase -
M3708_RS05610 (M3708_05610) 1099039..1099683 - 645 WP_006253274.1 tyrosine-type recombinase/integrase -
M3708_RS05615 (M3708_05615) 1100019..1100438 - 420 WP_006250074.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M3708_RS05620 (M3708_05620) 1100477..1100659 - 183 WP_006250075.1 type II toxin-antitoxin system HicA family toxin Toxin
M3708_RS05625 (M3708_05625) 1100791..1101288 - 498 WP_006250077.1 hypothetical protein -
M3708_RS05630 (M3708_05630) 1101281..1101661 - 381 WP_006248823.1 hypothetical protein -
M3708_RS05635 (M3708_05635) 1101736..1102419 - 684 WP_006248824.1 S24 family peptidase -
M3708_RS05640 (M3708_05640) 1102550..1102750 + 201 WP_006248825.1 YdaS family helix-turn-helix protein -
M3708_RS05645 (M3708_05645) 1102771..1103838 + 1068 WP_006253284.1 hypothetical protein -
M3708_RS05650 (M3708_05650) 1103848..1104006 + 159 WP_006247809.1 hypothetical protein -
M3708_RS05655 (M3708_05655) 1104015..1104314 - 300 WP_006247810.1 XRE family transcriptional regulator -
M3708_RS05660 (M3708_05660) 1104286..1104675 - 390 WP_015484247.1 type II toxin-antitoxin system RelE/ParE family toxin -
M3708_RS05665 (M3708_05665) 1104819..1105112 + 294 WP_006247812.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-96)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6933.03 Da        Isoelectric Point: 10.3446

>T245218 WP_006250075.1 NZ_CP097338:c1100659-1100477 [Mannheimia haemolytica]
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK

Download         Length: 183 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15938.30 Da        Isoelectric Point: 4.6963

>AT245218 WP_006250074.1 NZ_CP097338:c1100438-1100019 [Mannheimia haemolytica]
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQHFTILPH

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A378NFX7

Antitoxin

Source ID Structure
AlphaFold DB A0A378NFW9

References