Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 927483..928022 Replicon chromosome
Accession NZ_CP097338
Organism Mannheimia haemolytica strain P1148

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag M3708_RS04750 Protein ID WP_006247804.1
Coordinates 927483..927752 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag M3708_RS04755 Protein ID WP_006247803.1
Coordinates 927756..928022 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3708_RS04705 (M3708_04705) 922617..922916 + 300 WP_006247810.1 XRE family transcriptional regulator -
M3708_RS04710 (M3708_04710) 922925..923083 - 159 WP_006247809.1 hypothetical protein -
M3708_RS04715 (M3708_04715) 923093..923779 - 687 WP_006247808.1 hypothetical protein -
M3708_RS04720 (M3708_04720) 923890..924501 - 612 WP_006253310.1 hypothetical protein -
M3708_RS04725 (M3708_04725) 924550..925176 - 627 WP_006247807.1 tail assembly protein -
M3708_RS04730 (M3708_04730) 925398..926117 - 720 WP_006247806.1 preprotein translocase subunit YajC -
M3708_RS04735 (M3708_04735) 926107..926397 - 291 Protein_902 NlpC/P60 family protein -
M3708_RS04740 (M3708_04740) 926375..927085 - 711 WP_006253312.1 tape measure protein -
M3708_RS04745 (M3708_04745) 927145..927408 - 264 WP_006247805.1 hypothetical protein -
M3708_RS04750 (M3708_04750) 927483..927752 - 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
M3708_RS04755 (M3708_04755) 927756..928022 - 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
M3708_RS04760 (M3708_04760) 928090..928320 - 231 WP_006247802.1 DUF4035 domain-containing protein -
M3708_RS04765 (M3708_04765) 928365..928766 - 402 WP_006247801.1 hypothetical protein -
M3708_RS04770 (M3708_04770) 928849..929490 - 642 WP_006247800.1 hypothetical protein -
M3708_RS04775 (M3708_04775) 929522..929917 - 396 WP_006247799.1 phage tail terminator protein -
M3708_RS04780 (M3708_04780) 929942..930169 - 228 Protein_911 phage terminase large subunit family protein -
M3708_RS04785 (M3708_04785) 930319..930693 + 375 WP_006247798.1 hypothetical protein -
M3708_RS04790 (M3708_04790) 930701..930868 + 168 WP_006253314.1 DNA cytosine methyltransferase -
M3708_RS04795 (M3708_04795) 930949..931272 + 324 WP_006253316.1 helix-turn-helix domain-containing protein -
M3708_RS04800 (M3708_04800) 931176..931886 + 711 Protein_915 site-specific integrase -
M3708_RS04805 (M3708_04805) 931987..932622 + 636 Protein_916 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 916429..955412 38983
- flank IS/Tn - - 931987..932679 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T245217 WP_006247804.1 NZ_CP097338:c927752-927483 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT245217 WP_006247803.1 NZ_CP097338:c928022-927756 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References