Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 305267..305856 | Replicon | chromosome |
Accession | NZ_CP097338 | ||
Organism | Mannheimia haemolytica strain P1148 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | A0A248ZY19 |
Locus tag | M3708_RS01560 | Protein ID | WP_006248516.1 |
Coordinates | 305267..305599 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A248ZX26 |
Locus tag | M3708_RS01565 | Protein ID | WP_006248517.1 |
Coordinates | 305596..305856 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3708_RS01520 (M3708_01520) | 300462..301082 | - | 621 | WP_006248508.1 | dTMP kinase | - |
M3708_RS01525 (M3708_01525) | 301093..302127 | - | 1035 | WP_006248509.1 | endolytic transglycosylase MltG | - |
M3708_RS01545 (M3708_01545) | 302707..303234 | + | 528 | WP_006248512.1 | inorganic diphosphatase | - |
M3708_RS01550 (M3708_01550) | 303290..304045 | + | 756 | WP_006248513.1 | M48 family metallopeptidase | - |
M3708_RS01555 (M3708_01555) | 304109..305140 | - | 1032 | WP_006248514.1 | tryptophan--tRNA ligase | - |
M3708_RS01560 (M3708_01560) | 305267..305599 | - | 333 | WP_006248516.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M3708_RS01565 (M3708_01565) | 305596..305856 | - | 261 | WP_006248517.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
M3708_RS01570 (M3708_01570) | 305926..306594 | - | 669 | WP_006248518.1 | phosphoglycolate phosphatase | - |
M3708_RS01575 (M3708_01575) | 306681..307478 | - | 798 | WP_006248519.1 | prolipoprotein diacylglyceryl transferase | - |
M3708_RS01580 (M3708_01580) | 307486..308274 | - | 789 | WP_006248520.1 | sulfite exporter TauE/SafE family protein | - |
M3708_RS01585 (M3708_01585) | 308276..308920 | - | 645 | WP_006248521.1 | RNA pyrophosphohydrolase | - |
M3708_RS01590 (M3708_01590) | 309532..310677 | + | 1146 | WP_006248526.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12007.94 Da Isoelectric Point: 6.4597
>T245214 WP_006248516.1 NZ_CP097338:c305599-305267 [Mannheimia haemolytica]
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A248ZY19 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A248ZX26 |