Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 2471964..2472679 | Replicon | chromosome |
Accession | NZ_CP097337 | ||
Organism | Mannheimia haemolytica strain NCTC 9712 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M3706_RS12445 | Protein ID | WP_006250491.1 |
Coordinates | 2471964..2472392 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A248ZW87 |
Locus tag | M3706_RS12450 | Protein ID | WP_006248272.1 |
Coordinates | 2472392..2472679 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3706_RS12430 (M3706_12430) | 2467220..2468872 | + | 1653 | WP_006250488.1 | phospho-sugar mutase | - |
M3706_RS12435 (M3706_12435) | 2468925..2469857 | + | 933 | WP_006250489.1 | nucleoside hydrolase | - |
M3706_RS12440 (M3706_12440) | 2469879..2471960 | - | 2082 | WP_006250490.1 | ATP-dependent DNA helicase RecG | - |
M3706_RS12445 (M3706_12445) | 2471964..2472392 | - | 429 | WP_006250491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3706_RS12450 (M3706_12450) | 2472392..2472679 | - | 288 | WP_006248272.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M3706_RS12455 (M3706_12455) | 2472843..2474726 | + | 1884 | WP_006250492.1 | molecular chaperone HtpG | - |
M3706_RS12460 (M3706_12460) | 2474779..2474961 | + | 183 | WP_006250493.1 | hypothetical protein | - |
M3706_RS12465 (M3706_12465) | 2475125..2476840 | + | 1716 | WP_006248268.1 | proline--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16640.06 Da Isoelectric Point: 8.9269
>T245212 WP_006250491.1 NZ_CP097337:c2472392-2471964 [Mannheimia haemolytica]
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|