Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-MazE |
Location | 1961285..1961935 | Replicon | chromosome |
Accession | NZ_CP097337 | ||
Organism | Mannheimia haemolytica strain NCTC 9712 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A378NBZ4 |
Locus tag | M3706_RS09900 | Protein ID | WP_020831127.1 |
Coordinates | 1961285..1961674 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1D2Q6P1 |
Locus tag | M3706_RS09905 | Protein ID | WP_006251766.1 |
Coordinates | 1961675..1961935 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3706_RS09860 (M3706_09860) | 1956846..1957655 | - | 810 | WP_006250123.1 | metal ABC transporter permease | - |
M3706_RS09865 (M3706_09865) | 1957648..1958508 | - | 861 | WP_006250124.1 | metal ABC transporter permease | - |
M3706_RS09870 (M3706_09870) | 1958582..1959367 | - | 786 | WP_006251768.1 | hypothetical protein | - |
M3706_RS09895 (M3706_09895) | 1960027..1961265 | - | 1239 | WP_006251767.1 | peptidase T | - |
M3706_RS09900 (M3706_09900) | 1961285..1961674 | - | 390 | WP_020831127.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3706_RS09905 (M3706_09905) | 1961675..1961935 | - | 261 | WP_006251766.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
M3706_RS09910 (M3706_09910) | 1962051..1962263 | - | 213 | WP_006251765.1 | BrnA antitoxin family protein | - |
M3706_RS09915 (M3706_09915) | 1962264..1962551 | - | 288 | WP_006251764.1 | BrnT family toxin | - |
M3706_RS09920 (M3706_09920) | 1962714..1966247 | - | 3534 | WP_006251763.1 | transcription-repair coupling factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14575.87 Da Isoelectric Point: 7.7391
>T245211 WP_020831127.1 NZ_CP097337:c1961674-1961285 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLGYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLGYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378NBZ4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D2Q6P1 |