Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 1650328..1650850 | Replicon | chromosome |
Accession | NZ_CP097337 | ||
Organism | Mannheimia haemolytica strain NCTC 9712 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A249A107 |
Locus tag | M3706_RS08330 | Protein ID | WP_006249269.1 |
Coordinates | 1650554..1650850 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A378NDF7 |
Locus tag | M3706_RS08325 | Protein ID | WP_006250574.1 |
Coordinates | 1650328..1650570 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3706_RS08300 (M3706_08300) | 1646178..1647255 | - | 1078 | Protein_1622 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
M3706_RS08305 (M3706_08305) | 1647429..1648070 | - | 642 | WP_006250576.1 | orotate phosphoribosyltransferase | - |
M3706_RS08310 (M3706_08310) | 1648193..1649035 | - | 843 | WP_006250575.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
M3706_RS08315 (M3706_08315) | 1649095..1649670 | + | 576 | WP_006249272.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
M3706_RS08320 (M3706_08320) | 1649648..1650316 | - | 669 | WP_006249271.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
M3706_RS08325 (M3706_08325) | 1650328..1650570 | - | 243 | WP_006250574.1 | hypothetical protein | Antitoxin |
M3706_RS08330 (M3706_08330) | 1650554..1650850 | - | 297 | WP_006249269.1 | BrnT family toxin | Toxin |
M3706_RS08335 (M3706_08335) | 1650977..1653889 | - | 2913 | WP_006250573.1 | RNA polymerase-associated protein RapA | - |
M3706_RS08340 (M3706_08340) | 1654050..1654349 | - | 300 | WP_006249265.1 | hypothetical protein | - |
M3706_RS08345 (M3706_08345) | 1654470..1655795 | - | 1326 | WP_020831251.1 | anti-phage deoxyguanosine triphosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 12009.89 Da Isoelectric Point: 7.9454
>T245210 WP_006249269.1 NZ_CP097337:c1650850-1650554 [Mannheimia haemolytica]
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249A107 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378NDF7 |