Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 820992..821632 Replicon chromosome
Accession NZ_CP097337
Organism Mannheimia haemolytica strain NCTC 9712

Toxin (Protein)


Gene name hicA Uniprot ID A0A378NFX7
Locus tag M3706_RS04335 Protein ID WP_006250075.1
Coordinates 820992..821174 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A378NFW9
Locus tag M3706_RS04340 Protein ID WP_006250074.1
Coordinates 821213..821632 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3706_RS04300 (M3706_04300) 816496..817335 - 840 WP_006252350.1 Rha family transcriptional regulator -
M3706_RS04305 (M3706_04305) 817511..817771 - 261 WP_006252483.1 CII family transcriptional regulator -
M3706_RS04310 (M3706_04310) 817792..817992 - 201 WP_075271704.1 YdaS family helix-turn-helix protein -
M3706_RS04315 (M3706_04315) 818115..818783 + 669 WP_115262496.1 helix-turn-helix transcriptional regulator -
M3706_RS04320 (M3706_04320) 818797..819177 + 381 WP_006248823.1 hypothetical protein -
M3706_RS04325 (M3706_04325) 819170..819667 + 498 WP_021279966.1 hypothetical protein -
M3706_RS04330 (M3706_04330) 819733..820773 - 1041 WP_020824074.1 IS481 family transposase -
M3706_RS04335 (M3706_04335) 820992..821174 + 183 WP_006250075.1 type II toxin-antitoxin system HicA family toxin Toxin
M3706_RS04340 (M3706_04340) 821213..821632 + 420 WP_006250074.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M3706_RS04345 (M3706_04345) 821907..822137 + 231 WP_006250987.1 hypothetical protein -
M3706_RS04350 (M3706_04350) 822616..822939 - 324 WP_006250988.1 hypothetical protein -
M3706_RS04355 (M3706_04355) 823132..823317 + 186 WP_020824222.1 hypothetical protein -
M3706_RS04360 (M3706_04360) 823301..823465 + 165 WP_020824223.1 hypothetical protein -
M3706_RS04365 (M3706_04365) 823471..823929 + 459 WP_006253113.1 single-stranded DNA-binding protein -
M3706_RS04370 (M3706_04370) 823965..824324 + 360 WP_006250991.1 hypothetical protein -
M3706_RS04375 (M3706_04375) 824384..825187 + 804 WP_115262478.1 DUF2303 family protein -
M3706_RS04380 (M3706_04380) 825281..825718 + 438 WP_006250993.1 DUF6378 domain-containing protein -
M3706_RS04385 (M3706_04385) 825715..826419 - 705 WP_006253110.1 DUF4145 domain-containing protein -
M3706_RS04390 (M3706_04390) 826421..826600 + 180 WP_006251861.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 781602..828955 47353
- flank IS/Tn - - 819733..820773 1040


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-96)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6933.03 Da        Isoelectric Point: 10.3446

>T245209 WP_006250075.1 NZ_CP097337:820992-821174 [Mannheimia haemolytica]
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK

Download         Length: 183 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15938.30 Da        Isoelectric Point: 4.6963

>AT245209 WP_006250074.1 NZ_CP097337:821213-821632 [Mannheimia haemolytica]
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQHFTILPH

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A378NFX7

Antitoxin

Source ID Structure
AlphaFold DB A0A378NFW9

References