Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 488215..488855 Replicon chromosome
Accession NZ_CP097337
Organism Mannheimia haemolytica strain NCTC 9712

Toxin (Protein)


Gene name hicA Uniprot ID A0A378NFX7
Locus tag M3706_RS02710 Protein ID WP_006250075.1
Coordinates 488673..488855 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A378NET2
Locus tag M3706_RS02705 Protein ID WP_006250984.1
Coordinates 488215..488634 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3706_RS02655 (M3706_02655) 483439..483873 - 435 WP_020824225.1 DUF6378 domain-containing protein -
M3706_RS02660 (M3706_02660) 483967..484770 - 804 WP_020824224.1 DUF2303 family protein -
M3706_RS02665 (M3706_02665) 484842..485201 - 360 WP_006250991.1 hypothetical protein -
M3706_RS02670 (M3706_02670) 485237..485695 - 459 WP_006253113.1 single-stranded DNA-binding protein -
M3706_RS02675 (M3706_02675) 485701..485865 - 165 WP_020824223.1 hypothetical protein -
M3706_RS02680 (M3706_02680) 485849..486034 - 186 WP_020824222.1 hypothetical protein -
M3706_RS02685 (M3706_02685) 486227..486550 + 324 WP_006250988.1 hypothetical protein -
M3706_RS02690 (M3706_02690) 487029..487259 - 231 WP_006250987.1 hypothetical protein -
M3706_RS02695 (M3706_02695) 487559..487834 + 276 WP_006250986.1 type II toxin-antitoxin system RelE/ParE family toxin -
M3706_RS02700 (M3706_02700) 487843..488148 + 306 WP_006250985.1 HigA family addiction module antitoxin -
M3706_RS02705 (M3706_02705) 488215..488634 - 420 WP_006250984.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M3706_RS02710 (M3706_02710) 488673..488855 - 183 WP_006250075.1 type II toxin-antitoxin system HicA family toxin Toxin
M3706_RS02715 (M3706_02715) 488986..489483 - 498 WP_020824221.1 hypothetical protein -
M3706_RS02720 (M3706_02720) 489663..489857 - 195 WP_235658930.1 hypothetical protein -
M3706_RS02725 (M3706_02725) 489932..490615 - 684 WP_006252485.1 S24 family peptidase -
M3706_RS02730 (M3706_02730) 490746..490946 + 201 WP_006248825.1 YdaS family helix-turn-helix protein -
M3706_RS02735 (M3706_02735) 490967..491227 + 261 WP_006252483.1 CII family transcriptional regulator -
M3706_RS02740 (M3706_02740) 491403..492242 + 840 WP_006252350.1 Rha family transcriptional regulator -
M3706_RS02745 (M3706_02745) 492239..493285 + 1047 WP_020824125.1 conserved phage C-terminal domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 477857..528999 51142


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-96)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6933.03 Da        Isoelectric Point: 10.3446

>T245208 WP_006250075.1 NZ_CP097337:c488855-488673 [Mannheimia haemolytica]
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK

Download         Length: 183 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15957.34 Da        Isoelectric Point: 4.6983

>AT245208 WP_006250984.1 NZ_CP097337:c488634-488215 [Mannheimia haemolytica]
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQRFTILPH

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A378NFX7

Antitoxin

Source ID Structure
AlphaFold DB A0A378NET2

References