Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 319474..320122 | Replicon | chromosome |
| Accession | NZ_CP097337 | ||
| Organism | Mannheimia haemolytica strain NCTC 9712 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A249A099 |
| Locus tag | M3706_RS01795 | Protein ID | WP_006251221.1 |
| Coordinates | 319946..320122 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A248ZZL6 |
| Locus tag | M3706_RS01790 | Protein ID | WP_006251222.1 |
| Coordinates | 319474..319890 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3706_RS01750 (M3706_01750) | 315833..316267 | + | 435 | WP_006251230.1 | hypothetical protein | - |
| M3706_RS01755 (M3706_01755) | 316282..317268 | + | 987 | WP_062627922.1 | encapsulin | - |
| M3706_RS01760 (M3706_01760) | 317280..317477 | + | 198 | WP_032848903.1 | hypothetical protein | - |
| M3706_RS01765 (M3706_01765) | 317480..317857 | + | 378 | WP_006251227.1 | hypothetical protein | - |
| M3706_RS01770 (M3706_01770) | 317857..318201 | + | 345 | WP_006251226.1 | hypothetical protein | - |
| M3706_RS01775 (M3706_01775) | 318203..318571 | + | 369 | WP_006251225.1 | hypothetical protein | - |
| M3706_RS01780 (M3706_01780) | 318568..318948 | + | 381 | WP_006251224.1 | hypothetical protein | - |
| M3706_RS01785 (M3706_01785) | 318952..319434 | + | 483 | WP_006251223.1 | phage tail tube protein | - |
| M3706_RS01790 (M3706_01790) | 319474..319890 | - | 417 | WP_006251222.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M3706_RS01795 (M3706_01795) | 319946..320122 | - | 177 | WP_006251221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M3706_RS01800 (M3706_01800) | 320225..320890 | + | 666 | WP_015587050.1 | DUF6246 family protein | - |
| M3706_RS01805 (M3706_01805) | 320905..321138 | - | 234 | WP_020824316.1 | hypothetical protein | - |
| M3706_RS01810 (M3706_01810) | 321307..321765 | + | 459 | WP_006251218.1 | hypothetical protein | - |
| M3706_RS01815 (M3706_01815) | 322318..324813 | + | 2496 | WP_061888644.1 | phage tail length tape measure family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 288705..335651 | 46946 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6640.79 Da Isoelectric Point: 10.7708
>T245207 WP_006251221.1 NZ_CP097337:c320122-319946 [Mannheimia haemolytica]
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15519.91 Da Isoelectric Point: 4.3508
>AT245207 WP_006251222.1 NZ_CP097337:c319890-319474 [Mannheimia haemolytica]
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A099 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZZL6 |