Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 2620648..2621363 | Replicon | chromosome |
Accession | NZ_CP097336 | ||
Organism | Mannheimia haemolytica strain NCTC 10636 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M3705_RS13290 | Protein ID | WP_006250491.1 |
Coordinates | 2620648..2621076 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A248ZW87 |
Locus tag | M3705_RS13295 | Protein ID | WP_006248272.1 |
Coordinates | 2621076..2621363 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3705_RS13275 (M3705_13275) | 2615904..2617556 | + | 1653 | WP_249763762.1 | phospho-sugar mutase | - |
M3705_RS13280 (M3705_13280) | 2617609..2618541 | + | 933 | WP_015484792.1 | nucleoside hydrolase | - |
M3705_RS13285 (M3705_13285) | 2618563..2620644 | - | 2082 | WP_040080489.1 | ATP-dependent DNA helicase RecG | - |
M3705_RS13290 (M3705_13290) | 2620648..2621076 | - | 429 | WP_006250491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3705_RS13295 (M3705_13295) | 2621076..2621363 | - | 288 | WP_006248272.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M3705_RS13300 (M3705_13300) | 2621527..2623410 | + | 1884 | WP_040080490.1 | molecular chaperone HtpG | - |
M3705_RS13305 (M3705_13305) | 2623499..2623645 | + | 147 | WP_230269068.1 | hypothetical protein | - |
M3705_RS13310 (M3705_13310) | 2623790..2624830 | + | 1041 | WP_249763655.1 | IS481 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2615225..2615851 | 626 | |
- | flank | IS/Tn | - | - | 2623790..2624830 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16640.06 Da Isoelectric Point: 8.9269
>T245204 WP_006250491.1 NZ_CP097336:c2621076-2620648 [Mannheimia haemolytica]
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|