Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 1470412..1471013 | Replicon | chromosome |
| Accession | NZ_CP097336 | ||
| Organism | Mannheimia haemolytica strain NCTC 10636 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M3705_RS07445 | Protein ID | WP_249762741.1 |
| Coordinates | 1470705..1471013 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M3705_RS07440 | Protein ID | WP_249763608.1 |
| Coordinates | 1470412..1470708 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3705_RS07400 (M3705_07400) | 1466014..1466250 | - | 237 | WP_249762594.1 | hypothetical protein | - |
| M3705_RS07405 (M3705_07405) | 1466357..1466719 | - | 363 | WP_249763604.1 | hypothetical protein | - |
| M3705_RS07410 (M3705_07410) | 1466721..1467206 | - | 486 | WP_249762593.1 | DNA repair protein RadC | - |
| M3705_RS07415 (M3705_07415) | 1467285..1467650 | - | 366 | WP_249763605.1 | hypothetical protein | - |
| M3705_RS07420 (M3705_07420) | 1467741..1468094 | - | 354 | WP_015587028.1 | hypothetical protein | - |
| M3705_RS07425 (M3705_07425) | 1468189..1468596 | - | 408 | WP_249763606.1 | heme utilization protein | - |
| M3705_RS07430 (M3705_07430) | 1468866..1469270 | - | 405 | Protein_1435 | STY4534 family ICE replication protein | - |
| M3705_RS07435 (M3705_07435) | 1469736..1469993 | - | 258 | WP_249763607.1 | hypothetical protein | - |
| M3705_RS07440 (M3705_07440) | 1470412..1470708 | + | 297 | WP_249763608.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M3705_RS07445 (M3705_07445) | 1470705..1471013 | + | 309 | WP_249762741.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| M3705_RS07450 (M3705_07450) | 1471599..1473650 | - | 2052 | WP_249762589.1 | DNA topoisomerase III | - |
| M3705_RS07455 (M3705_07455) | 1473653..1473847 | - | 195 | WP_249763609.1 | hypothetical protein | - |
| M3705_RS07460 (M3705_07460) | 1474011..1474667 | + | 657 | WP_249763610.1 | hypothetical protein | - |
| M3705_RS07465 (M3705_07465) | 1474664..1475086 | - | 423 | WP_249762586.1 | hypothetical protein | - |
| M3705_RS07470 (M3705_07470) | 1475096..1475302 | - | 207 | WP_249762585.1 | hypothetical protein | - |
| M3705_RS07475 (M3705_07475) | 1475479..1475886 | - | 408 | WP_249762584.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1429127..1486735 | 57608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11867.67 Da Isoelectric Point: 7.9365
>T245201 WP_249762741.1 NZ_CP097336:1470705-1471013 [Mannheimia haemolytica]
IMESKPLKVSYSKQFVRDLTDLAKRHPNVLIGTKYITAIHCLLNRLPLPEGYQDHALSGEWKGYRDCHIQGDLVLIYQYV
IHDEFDELKFARLNTHSQTALK
IMESKPLKVSYSKQFVRDLTDLAKRHPNVLIGTKYITAIHCLLNRLPLPEGYQDHALSGEWKGYRDCHIQGDLVLIYQYV
IHDEFDELKFARLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|