Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafQ-RelB |
| Location | 978955..979556 | Replicon | chromosome |
| Accession | NZ_CP097336 | ||
| Organism | Mannheimia haemolytica strain NCTC 10636 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | M3705_RS05210 | Protein ID | WP_052500177.1 |
| Coordinates | 979248..979556 (+) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M3705_RS05205 | Protein ID | WP_044428321.1 |
| Coordinates | 978955..979251 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3705_RS05160 (M3705_05160) | 974310..974612 | + | 303 | WP_249763911.1 | hypothetical protein | - |
| M3705_RS05165 (M3705_05165) | 974769..975101 | + | 333 | WP_249763912.1 | hypothetical protein | - |
| M3705_RS05170 (M3705_05170) | 975202..975567 | + | 366 | WP_044428312.1 | hypothetical protein | - |
| M3705_RS05175 (M3705_05175) | 975646..976131 | + | 486 | WP_249763913.1 | DNA repair protein RadC | - |
| M3705_RS05180 (M3705_05180) | 976133..976495 | + | 363 | WP_044428316.1 | hypothetical protein | - |
| M3705_RS05185 (M3705_05185) | 976770..977315 | + | 546 | WP_044428318.1 | hypothetical protein | - |
| M3705_RS05190 (M3705_05190) | 977375..977551 | - | 177 | Protein_993 | IS481 family transposase | - |
| M3705_RS05195 (M3705_05195) | 977524..978066 | - | 543 | WP_080869764.1 | STY4534 family ICE replication protein | - |
| M3705_RS05200 (M3705_05200) | 978294..978536 | - | 243 | WP_044428320.1 | hypothetical protein | - |
| M3705_RS05205 (M3705_05205) | 978955..979251 | + | 297 | WP_044428321.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| M3705_RS05210 (M3705_05210) | 979248..979556 | + | 309 | WP_052500177.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| M3705_RS05215 (M3705_05215) | 979698..980738 | - | 1041 | WP_249763655.1 | IS481 family transposase | - |
| M3705_RS05220 (M3705_05220) | 980909..981742 | - | 834 | WP_044428186.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 973287..980738 | 7451 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11897.70 Da Isoelectric Point: 7.9365
>T245200 WP_052500177.1 NZ_CP097336:979248-979556 [Mannheimia haemolytica]
IMESKPLKVSYSKQFVRDLTDLAKRHPNVLIGTKYITAIHCLLNRLPLPESYQDHALSGEWKGYRDCHIQGDLVLIYQYV
IHDEFDELKFARLNTHSQTALK
IMESKPLKVSYSKQFVRDLTDLAKRHPNVLIGTKYITAIHCLLNRLPLPESYQDHALSGEWKGYRDCHIQGDLVLIYQYV
IHDEFDELKFARLNTHSQTALK
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|