Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 843848..844387 Replicon chromosome
Accession NZ_CP097336
Organism Mannheimia haemolytica strain NCTC 10636

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag M3705_RS04405 Protein ID WP_249763875.1
Coordinates 844118..844387 (+) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag M3705_RS04400 Protein ID WP_006247803.1
Coordinates 843848..844114 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3705_RS04350 (M3705_04350) 839025..840323 + 1299 WP_006250049.1 adenylosuccinate synthase -
M3705_RS04360 (M3705_04360) 840848..841000 - 153 WP_249763873.1 hypothetical protein -
M3705_RS04365 (M3705_04365) 841144..841533 + 390 WP_006247811.1 type II toxin-antitoxin system RelE/ParE family toxin -
M3705_RS04370 (M3705_04370) 841505..841804 + 300 WP_249763874.1 XRE family transcriptional regulator -
M3705_RS04375 (M3705_04375) 841813..841971 - 159 WP_006247809.1 hypothetical protein -
M3705_RS04380 (M3705_04380) 841981..842667 - 687 WP_006247808.1 hypothetical protein -
M3705_RS04385 (M3705_04385) 842771..843097 + 327 WP_249763950.1 DUF2190 family protein -
M3705_RS04390 (M3705_04390) 843090..843392 + 303 WP_015484709.1 bacteriophage tail protein -
M3705_RS04395 (M3705_04395) 843550..843780 + 231 WP_075271707.1 DUF4035 domain-containing protein -
M3705_RS04400 (M3705_04400) 843848..844114 + 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
M3705_RS04405 (M3705_04405) 844118..844387 + 270 WP_249763875.1 type II toxin-antitoxin system YafQ family toxin Toxin
M3705_RS04410 (M3705_04410) 844462..844725 + 264 WP_006247805.1 hypothetical protein -
M3705_RS04415 (M3705_04415) 844785..845114 + 330 WP_249763876.1 hypothetical protein -
M3705_RS04420 (M3705_04420) 845329..845637 + 309 Protein_840 hypothetical protein -
M3705_RS04425 (M3705_04425) 845700..846074 + 375 WP_249763877.1 hypothetical protein -
M3705_RS04430 (M3705_04430) 846082..846252 + 171 WP_249763878.1 DNA cytosine methyltransferase -
M3705_RS04435 (M3705_04435) 846333..846584 + 252 WP_249763879.1 helix-turn-helix domain-containing protein -
M3705_RS04440 (M3705_04440) 846560..847615 + 1056 WP_249763880.1 site-specific integrase -
M3705_RS04445 (M3705_04445) 847902..848243 - 342 WP_249763881.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 835312..886657 51345


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(1-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10205.85 Da        Isoelectric Point: 6.2121

>T245199 WP_249763875.1 NZ_CP097336:844118-844387 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGELQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT245199 WP_006247803.1 NZ_CP097336:843848-844114 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References