Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 823898..824495 | Replicon | chromosome |
Accession | NZ_CP097336 | ||
Organism | Mannheimia haemolytica strain NCTC 10636 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | M3705_RS04285 | Protein ID | WP_044427636.1 |
Coordinates | 824220..824495 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A547EKP0 |
Locus tag | M3705_RS04280 | Protein ID | WP_006249777.1 |
Coordinates | 823898..824227 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3705_RS04255 (M3705_04255) | 819339..820028 | + | 690 | WP_249763870.1 | GTP cyclohydrolase I FolE | - |
M3705_RS04260 (M3705_04260) | 820101..820886 | + | 786 | WP_031200754.1 | tRNA pseudouridine(38-40) synthase TruA | - |
M3705_RS04265 (M3705_04265) | 820939..823131 | - | 2193 | WP_249763871.1 | copper-translocating P-type ATPase | - |
M3705_RS04270 (M3705_04270) | 823184..823384 | - | 201 | WP_249762742.1 | cation transporter | - |
M3705_RS04275 (M3705_04275) | 823473..823859 | + | 387 | WP_006249778.1 | Cu(I)-responsive transcriptional regulator | - |
M3705_RS04280 (M3705_04280) | 823898..824227 | - | 330 | WP_006249777.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
M3705_RS04285 (M3705_04285) | 824220..824495 | - | 276 | WP_044427636.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
M3705_RS04290 (M3705_04290) | 824703..826610 | + | 1908 | WP_044427633.1 | DNA topoisomerase IV subunit B | - |
M3705_RS04295 (M3705_04295) | 826684..827289 | - | 606 | WP_006249773.1 | glycerol-3-phosphate 1-O-acyltransferase PlsY | - |
M3705_RS04300 (M3705_04300) | 827359..827715 | + | 357 | WP_006249772.1 | dihydroneopterin aldolase | - |
M3705_RS04305 (M3705_04305) | 827712..828613 | + | 902 | Protein_818 | DMT family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10384.08 Da Isoelectric Point: 10.2600
>T245198 WP_044427636.1 NZ_CP097336:c824495-824220 [Mannheimia haemolytica]
MVVKILKRKSQKTLQQIYTQPISANIKWTNIEALFLELGAEIEEREGSRIAVVLFQQVRVFHRPHPNPDTDKGAVASIKK
WLSENGVIPYA
MVVKILKRKSQKTLQQIYTQPISANIKWTNIEALFLELGAEIEEREGSRIAVVLFQQVRVFHRPHPNPDTDKGAVASIKK
WLSENGVIPYA
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|