Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 249965..250554 | Replicon | chromosome |
| Accession | NZ_CP097336 | ||
| Organism | Mannheimia haemolytica strain NCTC 10636 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | M3705_RS01365 | Protein ID | WP_249763812.1 |
| Coordinates | 249965..250297 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A248ZX26 |
| Locus tag | M3705_RS01370 | Protein ID | WP_006248517.1 |
| Coordinates | 250294..250554 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3705_RS01325 (M3705_01325) | 245161..245781 | - | 621 | WP_006248508.1 | dTMP kinase | - |
| M3705_RS01330 (M3705_01330) | 245792..246826 | - | 1035 | WP_249763811.1 | endolytic transglycosylase MltG | - |
| M3705_RS01350 (M3705_01350) | 247405..247932 | + | 528 | WP_006248512.1 | inorganic diphosphatase | - |
| M3705_RS01355 (M3705_01355) | 247988..248743 | + | 756 | WP_006248513.1 | M48 family metallopeptidase | - |
| M3705_RS01360 (M3705_01360) | 248807..249838 | - | 1032 | WP_006248514.1 | tryptophan--tRNA ligase | - |
| M3705_RS01365 (M3705_01365) | 249965..250297 | - | 333 | WP_249763812.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M3705_RS01370 (M3705_01370) | 250294..250554 | - | 261 | WP_006248517.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M3705_RS01375 (M3705_01375) | 250624..251292 | - | 669 | WP_006248518.1 | phosphoglycolate phosphatase | - |
| M3705_RS01380 (M3705_01380) | 251379..252176 | - | 798 | WP_006248519.1 | prolipoprotein diacylglyceryl transferase | - |
| M3705_RS01385 (M3705_01385) | 252184..252972 | - | 789 | WP_006248520.1 | sulfite exporter TauE/SafE family protein | - |
| M3705_RS01390 (M3705_01390) | 252974..253618 | - | 645 | WP_006248521.1 | RNA pyrophosphohydrolase | - |
| M3705_RS01395 (M3705_01395) | 254230..255375 | + | 1146 | WP_006248526.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11991.94 Da Isoelectric Point: 6.4597
>T245195 WP_249763812.1 NZ_CP097336:c250297-249965 [Mannheimia haemolytica]
MKRGDIYWLDLDPTLGHEQSGFRPVVIVAATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
MKRGDIYWLDLDPTLGHEQSGFRPVVIVAATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|