Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /BrnT(toxin) |
| Location | 1506787..1507309 | Replicon | chromosome |
| Accession | NZ_CP097335 | ||
| Organism | Mannheimia haemolytica strain NCTC 10208 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | M3704_RS07060 | Protein ID | WP_154704097.1 |
| Coordinates | 1507013..1507309 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | M3704_RS07055 | Protein ID | WP_021279403.1 |
| Coordinates | 1506787..1507029 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3704_RS07030 (M3704_07030) | 1502583..1503671 | - | 1089 | WP_154704102.1 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
| M3704_RS07035 (M3704_07035) | 1503851..1504492 | - | 642 | WP_154704101.1 | orotate phosphoribosyltransferase | - |
| M3704_RS07040 (M3704_07040) | 1504652..1505494 | - | 843 | WP_154704100.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| M3704_RS07045 (M3704_07045) | 1505554..1506129 | + | 576 | WP_154704099.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
| M3704_RS07050 (M3704_07050) | 1506107..1506775 | - | 669 | WP_154704098.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
| M3704_RS07055 (M3704_07055) | 1506787..1507029 | - | 243 | WP_021279403.1 | CopG family antitoxin | Antitoxin |
| M3704_RS07060 (M3704_07060) | 1507013..1507309 | - | 297 | WP_154704097.1 | BrnT family toxin | Toxin |
| M3704_RS07065 (M3704_07065) | 1507436..1510348 | - | 2913 | WP_154704096.1 | RNA polymerase-associated protein RapA | - |
| M3704_RS07070 (M3704_07070) | 1510509..1510868 | - | 360 | WP_126302319.1 | hypothetical protein | - |
| M3704_RS07075 (M3704_07075) | 1510931..1512256 | - | 1326 | WP_154704095.1 | anti-phage deoxyguanosine triphosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11943.75 Da Isoelectric Point: 7.9808
>T245193 WP_154704097.1 NZ_CP097335:c1507309-1507013 [Mannheimia haemolytica]
MYIDLQYAVPLLFEYDPNKSQINLAKHGIDFEQAKLLWEDERKVVLEACTEPELRYFAIGKIYDKYWTAFFTPRNDIIRL
ISVRRSRKKEISYYEKYH
MYIDLQYAVPLLFEYDPNKSQINLAKHGIDFEQAKLLWEDERKVVLEACTEPELRYFAIGKIYDKYWTAFFTPRNDIIRL
ISVRRSRKKEISYYEKYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|