Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-YefM |
| Location | 36040..36737 | Replicon | chromosome |
| Accession | NZ_CP097335 | ||
| Organism | Mannheimia haemolytica strain NCTC 10208 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M3704_RS00165 | Protein ID | WP_154703611.1 |
| Coordinates | 36040..36462 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M3704_RS00170 | Protein ID | WP_154703610.1 |
| Coordinates | 36462..36737 (-) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3704_RS00150 (M3704_00150) | 31296..32948 | + | 1653 | WP_154703614.1 | phospho-sugar mutase | - |
| M3704_RS00155 (M3704_00155) | 33001..33933 | + | 933 | WP_154703613.1 | nucleoside hydrolase | - |
| M3704_RS00160 (M3704_00160) | 33955..36036 | - | 2082 | WP_154703612.1 | ATP-dependent DNA helicase RecG | - |
| M3704_RS00165 (M3704_00165) | 36040..36462 | - | 423 | WP_154703611.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3704_RS00170 (M3704_00170) | 36462..36737 | - | 276 | WP_154703610.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M3704_RS00175 (M3704_00175) | 36901..38784 | + | 1884 | WP_154703609.1 | molecular chaperone HtpG | - |
| M3704_RS00180 (M3704_00180) | 38920..40635 | + | 1716 | WP_154703608.1 | proline--tRNA ligase | - |
| M3704_RS00185 (M3704_00185) | 40745..40801 | + | 57 | Protein_36 | PT domain-containing protein | - |
| M3704_RS00190 (M3704_00190) | 40797..40856 | + | 60 | Protein_37 | PT domain-containing protein | - |
| M3704_RS00195 (M3704_00195) | 40852..40903 | + | 52 | Protein_38 | PT domain-containing protein | - |
| M3704_RS00200 (M3704_00200) | 40951..41733 | + | 783 | WP_230311465.1 | glycosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 16213.77 Da Isoelectric Point: 7.6667
>T245190 WP_154703611.1 NZ_CP097335:c36462-36040 [Mannheimia haemolytica]
MYLLDTNIVSELRKASKGRADPNVMRWFSKVELQDCYLCSTVISEIRVGILAKKKRDVEQYYILNDWFENQLLTQFSNRI
LPLDLTAALLCAEFHIPDRSPINDAYIAAIAKANHLTLVTRNTKDFIRCDLRLFNPFETA
MYLLDTNIVSELRKASKGRADPNVMRWFSKVELQDCYLCSTVISEIRVGILAKKKRDVEQYYILNDWFENQLLTQFSNRI
LPLDLTAALLCAEFHIPDRSPINDAYIAAIAKANHLTLVTRNTKDFIRCDLRLFNPFETA
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|