Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 2185370..2186020 | Replicon | chromosome |
| Accession | NZ_CP097334 | ||
| Organism | Mannheimia haemolytica strain 183 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A547EDJ6 |
| Locus tag | M3707_RS11255 | Protein ID | WP_006249411.1 |
| Coordinates | 2185370..2185759 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A547EDM1 |
| Locus tag | M3707_RS11260 | Protein ID | WP_006249412.1 |
| Coordinates | 2185760..2186020 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3707_RS11200 (M3707_11200) | 2180641..2181450 | - | 810 | WP_006250123.1 | metal ABC transporter permease | - |
| M3707_RS11205 (M3707_11205) | 2181443..2182303 | - | 861 | WP_006250124.1 | metal ABC transporter permease | - |
| M3707_RS11210 (M3707_11210) | 2182377..2183162 | - | 786 | WP_006251768.1 | hypothetical protein | - |
| M3707_RS11250 (M3707_11250) | 2184112..2185350 | - | 1239 | WP_006253630.1 | peptidase T | - |
| M3707_RS11255 (M3707_11255) | 2185370..2185759 | - | 390 | WP_006249411.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3707_RS11260 (M3707_11260) | 2185760..2186020 | - | 261 | WP_006249412.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M3707_RS11265 (M3707_11265) | 2186136..2186348 | - | 213 | WP_006251765.1 | BrnA antitoxin family protein | - |
| M3707_RS11270 (M3707_11270) | 2186349..2186636 | - | 288 | WP_006251764.1 | BrnT family toxin | - |
| M3707_RS11275 (M3707_11275) | 2186799..2190332 | - | 3534 | WP_006253629.1 | transcription-repair coupling factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14633.91 Da Isoelectric Point: 7.1041
>T245189 WP_006249411.1 NZ_CP097334:c2185759-2185370 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSVTAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A547EDJ6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A547EDM1 |