Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 1416041..1416689 | Replicon | chromosome |
| Accession | NZ_CP097334 | ||
| Organism | Mannheimia haemolytica strain 183 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A249A099 |
| Locus tag | M3707_RS07155 | Protein ID | WP_006251221.1 |
| Coordinates | 1416041..1416217 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A248ZZL6 |
| Locus tag | M3707_RS07160 | Protein ID | WP_006251222.1 |
| Coordinates | 1416273..1416689 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3707_RS07135 (M3707_07135) | 1411359..1413854 | - | 2496 | WP_006251216.1 | phage tail length tape measure family protein | - |
| M3707_RS07140 (M3707_07140) | 1414399..1414857 | - | 459 | WP_006251218.1 | hypothetical protein | - |
| M3707_RS07145 (M3707_07145) | 1415026..1415259 | + | 234 | WP_020824316.1 | hypothetical protein | - |
| M3707_RS07150 (M3707_07150) | 1415274..1415939 | - | 666 | WP_015587050.1 | DUF6246 family protein | - |
| M3707_RS07155 (M3707_07155) | 1416041..1416217 | + | 177 | WP_006251221.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M3707_RS07160 (M3707_07160) | 1416273..1416689 | + | 417 | WP_006251222.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M3707_RS07165 (M3707_07165) | 1416729..1417211 | - | 483 | WP_006251223.1 | phage tail tube protein | - |
| M3707_RS07170 (M3707_07170) | 1417215..1417595 | - | 381 | WP_006251224.1 | hypothetical protein | - |
| M3707_RS07175 (M3707_07175) | 1417592..1417960 | - | 369 | WP_006251225.1 | hypothetical protein | - |
| M3707_RS07180 (M3707_07180) | 1417962..1418306 | - | 345 | WP_006251226.1 | hypothetical protein | - |
| M3707_RS07185 (M3707_07185) | 1418306..1418683 | - | 378 | WP_006251227.1 | hypothetical protein | - |
| M3707_RS07190 (M3707_07190) | 1418686..1418937 | - | 252 | WP_015484272.1 | hypothetical protein | - |
| M3707_RS07195 (M3707_07195) | 1418949..1419938 | - | 990 | WP_006251229.1 | encapsulin | - |
| M3707_RS07200 (M3707_07200) | 1419953..1420387 | - | 435 | WP_006251230.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1392253..1491093 | 98840 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6640.79 Da Isoelectric Point: 10.7708
>T245187 WP_006251221.1 NZ_CP097334:1416041-1416217 [Mannheimia haemolytica]
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
VKQSEFLRWLKANGVEVENGSKHLKLYYKGKRSHLPKHPSQELKTGLVEGVKKQLGLK
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15519.91 Da Isoelectric Point: 4.3508
>AT245187 WP_006251222.1 NZ_CP097334:1416273-1416689 [Mannheimia haemolytica]
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
MFYPALFTPAEEGGFVVTFPDLPEAITQGDTFEEAMEMAEDVLLSCVEIYFDEDRRFPLTRPVNTDEVPVFMPESIYAKV
LLHNTMQEQAVSKAEIARLTNIRPPEVQRILAPRHITKIDTIGRILASLGKPLQLSLG
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A249A099 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZZL6 |