Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 1101517..1102157 Replicon chromosome
Accession NZ_CP097334
Organism Mannheimia haemolytica strain 183

Toxin (Protein)


Gene name hicA Uniprot ID A0A378NFX7
Locus tag M3707_RS05645 Protein ID WP_006250075.1
Coordinates 1101975..1102157 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A378NFW9
Locus tag M3707_RS05640 Protein ID WP_006250074.1
Coordinates 1101517..1101936 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3707_RS05620 (M3707_05620) 1097064..1097870 + 807 WP_006248821.1 tryptophan synthase subunit alpha -
M3707_RS05625 (M3707_05625) 1097920..1099326 + 1407 WP_006253513.1 YdgA family protein -
M3707_RS05630 (M3707_05630) 1099393..1100399 - 1007 Protein_1077 IS481 family transposase -
M3707_RS05635 (M3707_05635) 1100537..1101181 - 645 WP_006253274.1 tyrosine-type recombinase/integrase -
M3707_RS05640 (M3707_05640) 1101517..1101936 - 420 WP_006250074.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
M3707_RS05645 (M3707_05645) 1101975..1102157 - 183 WP_006250075.1 type II toxin-antitoxin system HicA family toxin Toxin
M3707_RS05650 (M3707_05650) 1102289..1102786 - 498 WP_006250077.1 hypothetical protein -
M3707_RS05655 (M3707_05655) 1102779..1103159 - 381 WP_006248823.1 hypothetical protein -
M3707_RS05660 (M3707_05660) 1103234..1103917 - 684 WP_006248824.1 S24 family peptidase -
M3707_RS05665 (M3707_05665) 1104048..1104248 + 201 WP_006248825.1 YdaS family helix-turn-helix protein -
M3707_RS05670 (M3707_05670) 1104269..1105336 + 1068 WP_006253284.1 hypothetical protein -
M3707_RS05675 (M3707_05675) 1105346..1105504 + 159 WP_006247809.1 hypothetical protein -
M3707_RS05680 (M3707_05680) 1105513..1105812 - 300 WP_006247810.1 XRE family transcriptional regulator -
M3707_RS05685 (M3707_05685) 1105784..1106173 - 390 WP_015484247.1 type II toxin-antitoxin system RelE/ParE family toxin -
M3707_RS05690 (M3707_05690) 1106317..1106610 + 294 WP_006247812.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-58)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-96)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6933.03 Da        Isoelectric Point: 10.3446

>T245186 WP_006250075.1 NZ_CP097334:c1102157-1101975 [Mannheimia haemolytica]
MKYSEFLRYLLAQGCEIENHRRGSHRKVTLNGKQSVFPYHGSKEIGTGLVNKIKKDLDLK

Download         Length: 183 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15938.30 Da        Isoelectric Point: 4.6963

>AT245186 WP_006250074.1 NZ_CP097334:c1101936-1101517 [Mannheimia haemolytica]
MLRYPVEITPDDNGTYLVTCPDIPEMASVGEDLEEALLEAQDGLATALEFYFDDRREIPMPSPIKEGQHTVNLTVLQSMK
VFLLNEMIKQGVRKAEMARRLDVHLPQIDRLLDFNHSTKVEFVEKAYGKLNQHFTILPH

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A378NFX7

Antitoxin

Source ID Structure
AlphaFold DB A0A378NFW9

References