Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 882882..883421 Replicon chromosome
Accession NZ_CP097334
Organism Mannheimia haemolytica strain 183

Toxin (Protein)


Gene name relE Uniprot ID A0A248ZYA9
Locus tag M3707_RS04480 Protein ID WP_006247804.1
Coordinates 882882..883151 (-) Length 90 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A547E920
Locus tag M3707_RS04485 Protein ID WP_006247803.1
Coordinates 883155..883421 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3707_RS04435 (M3707_04435) 878016..878315 + 300 WP_006247810.1 XRE family transcriptional regulator -
M3707_RS04440 (M3707_04440) 878324..878482 - 159 WP_006247809.1 hypothetical protein -
M3707_RS04445 (M3707_04445) 878492..879178 - 687 WP_006247808.1 hypothetical protein -
M3707_RS04450 (M3707_04450) 879289..879900 - 612 WP_006253310.1 hypothetical protein -
M3707_RS04455 (M3707_04455) 879949..880575 - 627 WP_006247807.1 tail assembly protein -
M3707_RS04460 (M3707_04460) 880797..881516 - 720 WP_006247806.1 preprotein translocase subunit YajC -
M3707_RS04465 (M3707_04465) 881506..881796 - 291 Protein_844 NlpC/P60 family protein -
M3707_RS04470 (M3707_04470) 881774..882484 - 711 WP_006253312.1 tape measure protein -
M3707_RS04475 (M3707_04475) 882544..882807 - 264 WP_006247805.1 hypothetical protein -
M3707_RS04480 (M3707_04480) 882882..883151 - 270 WP_006247804.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
M3707_RS04485 (M3707_04485) 883155..883421 - 267 WP_006247803.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
M3707_RS04490 (M3707_04490) 883489..883719 - 231 WP_006247802.1 DUF4035 domain-containing protein -
M3707_RS04495 (M3707_04495) 883764..884165 - 402 WP_006247801.1 hypothetical protein -
M3707_RS04500 (M3707_04500) 884248..884889 - 642 WP_006247800.1 hypothetical protein -
M3707_RS04505 (M3707_04505) 884921..885316 - 396 WP_006247799.1 phage tail terminator protein -
M3707_RS04510 (M3707_04510) 885341..885568 - 228 Protein_853 phage terminase large subunit family protein -
M3707_RS04515 (M3707_04515) 885718..886092 + 375 WP_006247798.1 hypothetical protein -
M3707_RS04520 (M3707_04520) 886100..886267 + 168 WP_006253314.1 DNA cytosine methyltransferase -
M3707_RS04525 (M3707_04525) 886348..886671 + 324 WP_006253316.1 helix-turn-helix domain-containing protein -
M3707_RS04530 (M3707_04530) 886575..887285 + 711 Protein_857 site-specific integrase -
M3707_RS04535 (M3707_04535) 887386..888021 + 636 Protein_858 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 871828..897328 25500
- flank IS/Tn - - 887386..888078 692


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(6-75)


Sequences

Toxin        


Download         Length: 90 a.a.        Molecular weight: 10278.90 Da        Isoelectric Point: 6.2121

>T245185 WP_006247804.1 NZ_CP097334:c883151-882882 [Mannheimia haemolytica]
MLQISPTNAYKRDFKKIAAELVGSSEYVEVMYCLINQLPLAEKYRDHPLQGEWQGFRDCHIKPDLVLIYAVEDNLLRLVR
LGSHAELFG

Download         Length: 270 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9913.38 Da        Isoelectric Point: 7.0082

>AT245185 WP_006247803.1 NZ_CP097334:c883421-883155 [Mannheimia haemolytica]
MATINDAFSFRTNTEIKNTAFDVIKNYGMTPSQVFNMFLTEIAKTKTIPLSLNYQPNLETKLAMQEAKSGKNEVYASLEA
FHKAMLAE

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A248ZYA9

Antitoxin

Source ID Structure
AlphaFold DB A0A547E920

References