Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 305711..306300 | Replicon | chromosome |
| Accession | NZ_CP097334 | ||
| Organism | Mannheimia haemolytica strain 183 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A248ZY19 |
| Locus tag | M3707_RS01570 | Protein ID | WP_006248516.1 |
| Coordinates | 305711..306043 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A248ZX26 |
| Locus tag | M3707_RS01575 | Protein ID | WP_006248517.1 |
| Coordinates | 306040..306300 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3707_RS01530 (M3707_01530) | 300906..301526 | - | 621 | WP_006248508.1 | dTMP kinase | - |
| M3707_RS01535 (M3707_01535) | 301537..302571 | - | 1035 | WP_006248509.1 | endolytic transglycosylase MltG | - |
| M3707_RS01555 (M3707_01555) | 303151..303678 | + | 528 | WP_006248512.1 | inorganic diphosphatase | - |
| M3707_RS01560 (M3707_01560) | 303734..304489 | + | 756 | WP_006248513.1 | M48 family metallopeptidase | - |
| M3707_RS01565 (M3707_01565) | 304553..305584 | - | 1032 | WP_006248514.1 | tryptophan--tRNA ligase | - |
| M3707_RS01570 (M3707_01570) | 305711..306043 | - | 333 | WP_006248516.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M3707_RS01575 (M3707_01575) | 306040..306300 | - | 261 | WP_006248517.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M3707_RS01580 (M3707_01580) | 306370..307038 | - | 669 | WP_006248518.1 | phosphoglycolate phosphatase | - |
| M3707_RS01585 (M3707_01585) | 307125..307922 | - | 798 | WP_006248519.1 | prolipoprotein diacylglyceryl transferase | - |
| M3707_RS01590 (M3707_01590) | 307930..308718 | - | 789 | WP_006248520.1 | sulfite exporter TauE/SafE family protein | - |
| M3707_RS01595 (M3707_01595) | 308720..309364 | - | 645 | WP_006248521.1 | RNA pyrophosphohydrolase | - |
| M3707_RS01600 (M3707_01600) | 309976..311121 | + | 1146 | WP_006248526.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12007.94 Da Isoelectric Point: 6.4597
>T245182 WP_006248516.1 NZ_CP097334:c306043-305711 [Mannheimia haemolytica]
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZY19 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZX26 |