Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 739514..740036 | Replicon | chromosome |
Accession | NZ_CP097333 | ||
Organism | Mannheimia haemolytica strain 184 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A249A107 |
Locus tag | M3709_RS03745 | Protein ID | WP_006249269.1 |
Coordinates | 739514..739810 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A249A190 |
Locus tag | M3709_RS03750 | Protein ID | WP_006249270.1 |
Coordinates | 739794..740036 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3709_RS03730 (M3709_03730) | 734568..735893 | + | 1326 | WP_020831251.1 | anti-phage deoxyguanosine triphosphatase | - |
M3709_RS03735 (M3709_03735) | 736014..736313 | + | 300 | WP_006249265.1 | hypothetical protein | - |
M3709_RS03740 (M3709_03740) | 736475..739387 | + | 2913 | WP_006249267.1 | RNA polymerase-associated protein RapA | - |
M3709_RS03745 (M3709_03745) | 739514..739810 | + | 297 | WP_006249269.1 | BrnT family toxin | Toxin |
M3709_RS03750 (M3709_03750) | 739794..740036 | + | 243 | WP_006249270.1 | CopG family antitoxin | Antitoxin |
M3709_RS03755 (M3709_03755) | 740048..740716 | + | 669 | WP_006249271.1 | bifunctional tRNA pseudouridine(32) synthase/23S rRNA pseudouridine(746) synthase RluA | - |
M3709_RS03760 (M3709_03760) | 740694..741269 | - | 576 | WP_006249272.1 | 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD | - |
M3709_RS03765 (M3709_03765) | 741329..742171 | + | 843 | WP_006250575.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
M3709_RS03770 (M3709_03770) | 742294..742935 | + | 642 | WP_040080687.1 | orotate phosphoribosyltransferase | - |
M3709_RS03775 (M3709_03775) | 743109..744186 | + | 1078 | Protein_715 | 5-methyltetrahydropteroyltriglutamate-- homocysteine S-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 12009.89 Da Isoelectric Point: 7.9454
>T245178 WP_006249269.1 NZ_CP097333:739514-739810 [Mannheimia haemolytica]
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
MYIDLQYAVPLLFEYDPNKSQINLAKYGIDFEQAKLLWEDERKVVLEACIEPELRYFLIGKIYDKYWTAFFTPRNDVIRL
ISVRRSRKKEISYYEKYH
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249A107 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249A190 |