Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 286662..287251 | Replicon | chromosome |
| Accession | NZ_CP097333 | ||
| Organism | Mannheimia haemolytica strain 184 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | A0A248ZY19 |
| Locus tag | M3709_RS01445 | Protein ID | WP_006248516.1 |
| Coordinates | 286662..286994 (-) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A248ZX26 |
| Locus tag | M3709_RS01450 | Protein ID | WP_006248517.1 |
| Coordinates | 286991..287251 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3709_RS01405 (M3709_01405) | 281767..282801 | - | 1035 | WP_006248509.1 | endolytic transglycosylase MltG | - |
| M3709_RS01425 (M3709_01425) | 283381..283908 | + | 528 | WP_006248512.1 | inorganic diphosphatase | - |
| M3709_RS01430 (M3709_01430) | 284005..284658 | - | 654 | WP_040080515.1 | IS1595 family transposase | - |
| M3709_RS01435 (M3709_01435) | 284730..285440 | + | 711 | WP_052437178.1 | M48 family metallopeptidase | - |
| M3709_RS01440 (M3709_01440) | 285504..286535 | - | 1032 | WP_006248514.1 | tryptophan--tRNA ligase | - |
| M3709_RS01445 (M3709_01445) | 286662..286994 | - | 333 | WP_006248516.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M3709_RS01450 (M3709_01450) | 286991..287251 | - | 261 | WP_006248517.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M3709_RS01455 (M3709_01455) | 287321..287989 | - | 669 | WP_006248518.1 | phosphoglycolate phosphatase | - |
| M3709_RS01460 (M3709_01460) | 288076..288873 | - | 798 | WP_021279892.1 | prolipoprotein diacylglyceryl transferase | - |
| M3709_RS01465 (M3709_01465) | 288881..289669 | - | 789 | WP_006248520.1 | sulfite exporter TauE/SafE family protein | - |
| M3709_RS01470 (M3709_01470) | 289671..290315 | - | 645 | WP_006248521.1 | RNA pyrophosphohydrolase | - |
| M3709_RS01475 (M3709_01475) | 290927..292072 | + | 1146 | WP_040080565.1 | FMN-dependent L-lactate dehydrogenase LldD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 284005..284658 | 653 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12007.94 Da Isoelectric Point: 6.4597
>T245176 WP_006248516.1 NZ_CP097333:c286994-286662 [Mannheimia haemolytica]
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
MKRGDIYWLDLDPTLGHEQSGFRPVVIVSATAFNLASKLPVVVPITNGGAFAERLGFAVSLKDAGLKTTGIIRCDQPRTV
DIAQRHGKFIEALPESLLDEIMARVSVIFE
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZY19 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A248ZX26 |