Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 53327..54042 | Replicon | chromosome |
Accession | NZ_CP097333 | ||
Organism | Mannheimia haemolytica strain 184 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M3709_RS00245 | Protein ID | WP_006250491.1 |
Coordinates | 53327..53755 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A248ZW87 |
Locus tag | M3709_RS00250 | Protein ID | WP_006248272.1 |
Coordinates | 53755..54042 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3709_RS00230 (M3709_00230) | 48582..50234 | + | 1653 | WP_040080487.1 | phospho-sugar mutase | - |
M3709_RS00235 (M3709_00235) | 50287..51220 | + | 934 | Protein_46 | nucleoside hydrolase | - |
M3709_RS00240 (M3709_00240) | 51242..53323 | - | 2082 | WP_040080489.1 | ATP-dependent DNA helicase RecG | - |
M3709_RS00245 (M3709_00245) | 53327..53755 | - | 429 | WP_006250491.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M3709_RS00250 (M3709_00250) | 53755..54042 | - | 288 | WP_006248272.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M3709_RS00255 (M3709_00255) | 54206..56089 | + | 1884 | WP_040080490.1 | molecular chaperone HtpG | - |
M3709_RS00260 (M3709_00260) | 56178..56324 | + | 147 | WP_230269068.1 | hypothetical protein | - |
M3709_RS00265 (M3709_00265) | 56469..57509 | + | 1041 | WP_040080492.1 | IS481 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 56469..57509 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 16640.06 Da Isoelectric Point: 8.9269
>T245175 WP_006250491.1 NZ_CP097333:c53755-53327 [Mannheimia haemolytica]
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
MYRYLFDTNIVSELYKLRNDKMDVNVRQWLRGVNPSQTNISCITLSEIKTGILLKARKDKEQSDRLNDWFENNVLKAYQT
KAFVVNNDIALLASEYHIPNKMDLNDAYIAATAKYHNLILVTRNTKDFIRCDVRLFNPFETA
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|