Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 3487901..3488580 | Replicon | chromosome |
| Accession | NZ_CP097330 | ||
| Organism | Cupriavidus campinensis strain G5 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5D45_RS16510 | Protein ID | WP_144202030.1 |
| Coordinates | 3487901..3488329 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5D45_RS16515 | Protein ID | WP_144202032.1 |
| Coordinates | 3488326..3488580 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D45_RS16490 (M5D45_16490) | 3484265..3485116 | - | 852 | WP_144202020.1 | hypothetical protein | - |
| M5D45_RS16495 (M5D45_16495) | 3485322..3485948 | + | 627 | WP_211943605.1 | DNA-3-methyladenine glycosylase I | - |
| M5D45_RS16500 (M5D45_16500) | 3486357..3486986 | + | 630 | WP_144202025.1 | LysE family translocator | - |
| M5D45_RS16505 (M5D45_16505) | 3486942..3487904 | - | 963 | WP_144202028.1 | cation diffusion facilitator family transporter | - |
| M5D45_RS16510 (M5D45_16510) | 3487901..3488329 | - | 429 | WP_144202030.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5D45_RS16515 (M5D45_16515) | 3488326..3488580 | - | 255 | WP_144202032.1 | Arc family DNA-binding protein | Antitoxin |
| M5D45_RS16525 (M5D45_16525) | 3488887..3490608 | - | 1722 | WP_250024873.1 | thiosulfohydrolase SoxB | - |
| M5D45_RS16530 (M5D45_16530) | 3490628..3491332 | - | 705 | WP_250024874.1 | sulfur oxidation c-type cytochrome SoxX | - |
| M5D45_RS16535 (M5D45_16535) | 3491350..3492189 | - | 840 | WP_144202059.1 | sulfur oxidation c-type cytochrome SoxA | - |
| M5D45_RS16540 (M5D45_16540) | 3492322..3492795 | - | 474 | WP_144202061.1 | DsrE family protein | - |
| M5D45_RS16545 (M5D45_16545) | 3492818..3493129 | - | 312 | WP_092300146.1 | thiosulfate oxidation carrier complex protein SoxZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15103.36 Da Isoelectric Point: 6.2243
>T245173 WP_144202030.1 NZ_CP097330:c3488329-3487901 [Cupriavidus campinensis]
MIVLDTNVVSEAMKPEPNPAVRAWLNAQVAETLYLSSVTLAELLFGIGALPEGRRKHGLSETLDGLLALFGDRVLMFDTG
AARHYAELAVKARLAGKGFPTPDGYIGAIAASRGYIVATRDTAPFEAAGLTVINPWNHSSIP
MIVLDTNVVSEAMKPEPNPAVRAWLNAQVAETLYLSSVTLAELLFGIGALPEGRRKHGLSETLDGLLALFGDRVLMFDTG
AARHYAELAVKARLAGKGFPTPDGYIGAIAASRGYIVATRDTAPFEAAGLTVINPWNHSSIP
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|