Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-vapB/MazF(toxin) |
| Location | 4384560..4385167 | Replicon | chromosome |
| Accession | NZ_CP097329 | ||
| Organism | Pseudanabaena mucicola str. Chao 1806 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M4D78_RS21185 | Protein ID | WP_286393238.1 |
| Coordinates | 4384811..4385167 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M4D78_RS21180 | Protein ID | WP_286393237.1 |
| Coordinates | 4384560..4384778 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4D78_RS21120 | 4380476..4380637 | - | 162 | WP_286393218.1 | hypothetical protein | - |
| M4D78_RS21125 | 4380624..4381022 | - | 399 | WP_286393219.1 | hypothetical protein | - |
| M4D78_RS21130 | 4381086..4381334 | + | 249 | WP_286393220.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| M4D78_RS21135 | 4381335..4381670 | + | 336 | WP_286393222.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| M4D78_RS21140 | 4381972..4382229 | + | 258 | WP_286393223.1 | hypothetical protein | - |
| M4D78_RS21145 | 4382239..4382646 | + | 408 | WP_286393224.1 | PIN domain-containing protein | - |
| M4D78_RS21150 | 4382630..4382845 | + | 216 | WP_286393226.1 | hypothetical protein | - |
| M4D78_RS21155 | 4382826..4383071 | - | 246 | WP_286393228.1 | hypothetical protein | - |
| M4D78_RS21160 | 4383257..4383625 | - | 369 | WP_286393230.1 | DUF5615 family PIN-like protein | - |
| M4D78_RS21165 | 4383622..4383870 | - | 249 | WP_286393231.1 | DUF433 domain-containing protein | - |
| M4D78_RS21170 | 4383862..4384023 | + | 162 | WP_286393234.1 | hypothetical protein | - |
| M4D78_RS21175 | 4384151..4384570 | - | 420 | WP_286393236.1 | putative toxin-antitoxin system toxin component, PIN family | - |
| M4D78_RS21180 | 4384560..4384778 | - | 219 | WP_286393237.1 | hypothetical protein | Antitoxin |
| M4D78_RS21185 | 4384811..4385167 | - | 357 | WP_286393238.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M4D78_RS21190 | 4385164..4385430 | - | 267 | WP_142601706.1 | hypothetical protein | - |
| M4D78_RS21195 | 4385555..4385686 | - | 132 | WP_286393240.1 | hypothetical protein | - |
| M4D78_RS21200 | 4385837..4387072 | - | 1236 | WP_286393243.1 | hypothetical protein | - |
| M4D78_RS21205 | 4387403..4387606 | - | 204 | WP_286393244.1 | hypothetical protein | - |
| M4D78_RS21210 | 4387829..4388083 | + | 255 | WP_286393246.1 | hypothetical protein | - |
| M4D78_RS21215 | 4388080..4388517 | + | 438 | WP_286393247.1 | PIN domain-containing protein | - |
| M4D78_RS21220 | 4388567..4389631 | - | 1065 | WP_286393248.1 | ACR3 family arsenite efflux transporter | - |
| M4D78_RS21225 | 4389720..4390046 | + | 327 | WP_286393249.1 | metalloregulator ArsR/SmtB family transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13303.32 Da Isoelectric Point: 9.0965
>T245170 WP_286393238.1 NZ_CP097329:c4385167-4384811 [Pseudanabaena mucicola str. Chao 1806]
MNIQRGDIVLVDYPYTSSSETKVRPVLVIQNDRDNQRLKNTIVVQITSQTQRSLETTQLLIKMATYEGQESGLRQDSVIN
CVNLLTLSKDKILRKLGQLPNSSLQKVNDCLKAALELT
MNIQRGDIVLVDYPYTSSSETKVRPVLVIQNDRDNQRLKNTIVVQITSQTQRSLETTQLLIKMATYEGQESGLRQDSVIN
CVNLLTLSKDKILRKLGQLPNSSLQKVNDCLKAALELT
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|