Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 4384151..4384778 Replicon chromosome
Accession NZ_CP097329
Organism Pseudanabaena mucicola str. Chao 1806

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag M4D78_RS21175 Protein ID WP_286393236.1
Coordinates 4384151..4384570 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag M4D78_RS21180 Protein ID WP_286393237.1
Coordinates 4384560..4384778 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4D78_RS21115 4379286..4380290 - 1005 WP_286393217.1 ArsJ-associated glyceraldehyde-3-phosphate dehydrogenase -
M4D78_RS21120 4380476..4380637 - 162 WP_286393218.1 hypothetical protein -
M4D78_RS21125 4380624..4381022 - 399 WP_286393219.1 hypothetical protein -
M4D78_RS21130 4381086..4381334 + 249 WP_286393220.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
M4D78_RS21135 4381335..4381670 + 336 WP_286393222.1 type II toxin-antitoxin system PemK/MazF family toxin -
M4D78_RS21140 4381972..4382229 + 258 WP_286393223.1 hypothetical protein -
M4D78_RS21145 4382239..4382646 + 408 WP_286393224.1 PIN domain-containing protein -
M4D78_RS21150 4382630..4382845 + 216 WP_286393226.1 hypothetical protein -
M4D78_RS21155 4382826..4383071 - 246 WP_286393228.1 hypothetical protein -
M4D78_RS21160 4383257..4383625 - 369 WP_286393230.1 DUF5615 family PIN-like protein -
M4D78_RS21165 4383622..4383870 - 249 WP_286393231.1 DUF433 domain-containing protein -
M4D78_RS21170 4383862..4384023 + 162 WP_286393234.1 hypothetical protein -
M4D78_RS21175 4384151..4384570 - 420 WP_286393236.1 putative toxin-antitoxin system toxin component, PIN family Toxin
M4D78_RS21180 4384560..4384778 - 219 WP_286393237.1 hypothetical protein Antitoxin
M4D78_RS21185 4384811..4385167 - 357 WP_286393238.1 type II toxin-antitoxin system PemK/MazF family toxin -
M4D78_RS21190 4385164..4385430 - 267 WP_142601706.1 hypothetical protein -
M4D78_RS21195 4385555..4385686 - 132 WP_286393240.1 hypothetical protein -
M4D78_RS21200 4385837..4387072 - 1236 WP_286393243.1 hypothetical protein -
M4D78_RS21205 4387403..4387606 - 204 WP_286393244.1 hypothetical protein -
M4D78_RS21210 4387829..4388083 + 255 WP_286393246.1 hypothetical protein -
M4D78_RS21215 4388080..4388517 + 438 WP_286393247.1 PIN domain-containing protein -
M4D78_RS21220 4388567..4389631 - 1065 WP_286393248.1 ACR3 family arsenite efflux transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN family, putative toxin-antitoxin system toxin component

(6-135)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15838.39 Da        Isoelectric Point: 4.7296

>T245169 WP_286393236.1 NZ_CP097329:c4384570-4384151 [Pseudanabaena mucicola str. Chao 1806]
MQGNPLRLVIDTNIWISFLIGKSLTGLSEAIISDQVIVLFSNDLFGELIKVLKRPKFKKYFSETAIEDLVTLLYEKVELI
EITHHFEDCRDAKDNFLLDLAVSGHANYLVTGDADLLILNPFQGVEIISYQHFQNLILK

Download         Length: 420 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8290.36 Da        Isoelectric Point: 4.3611

>AT245169 WP_286393237.1 NZ_CP097329:c4384778-4384560 [Pseudanabaena mucicola str. Chao 1806]
MNVSISIDFSQLKTAIAQCNLEEKLELLQLLEKDTFSVRFNKFLSSVQTDELSLEDITQEVEAVRQANYHAR

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References