Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 4283260..4283903 | Replicon | chromosome |
Accession | NZ_CP097329 | ||
Organism | Pseudanabaena mucicola str. Chao 1806 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M4D78_RS20650 | Protein ID | WP_286393085.1 |
Coordinates | 4283260..4283649 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M4D78_RS20655 | Protein ID | WP_286393087.1 |
Coordinates | 4283658..4283903 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4D78_RS20635 | 4278582..4281938 | + | 3357 | WP_286393082.1 | Swt1 family HEPN domain-containing protein | - |
M4D78_RS20640 | 4282376..4282633 | - | 258 | WP_286393083.1 | glutaredoxin family protein | - |
M4D78_RS20650 | 4283260..4283649 | - | 390 | WP_286393085.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M4D78_RS20655 | 4283658..4283903 | - | 246 | WP_286393087.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M4D78_RS20660 | 4283937..4284161 | - | 225 | WP_286393089.1 | putative molybdenum carrier protein | - |
M4D78_RS20665 | 4284282..4284671 | - | 390 | WP_286393091.1 | nuclease A inhibitor family protein | - |
M4D78_RS20670 | 4284806..4285156 | + | 351 | WP_286393093.1 | hypothetical protein | - |
M4D78_RS20675 | 4285295..4285711 | + | 417 | WP_286393095.1 | hypothetical protein | - |
M4D78_RS20680 | 4285776..4286144 | + | 369 | WP_286393097.1 | hypothetical protein | - |
M4D78_RS20685 | 4286196..4286465 | + | 270 | WP_286393099.1 | transposase | - |
M4D78_RS20695 | 4286778..4287791 | - | 1014 | WP_286393100.1 | ferrochelatase | - |
M4D78_RS20700 | 4288184..4288570 | - | 387 | WP_286393102.1 | response regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14671.87 Da Isoelectric Point: 4.6461
>T245168 WP_286393085.1 NZ_CP097329:c4283649-4283260 [Pseudanabaena mucicola str. Chao 1806]
MDTHIWLWWFAQPERLSEEAIACIVDETNEVWFSVASVWEMSIKVALGKLPLPEPVDSYISSRMVQLGARSLDISVNHAL
KAAALPLHHRDPFDRMLIAQAQLENITIVTADHMFSQYQDVSILWAANL
MDTHIWLWWFAQPERLSEEAIACIVDETNEVWFSVASVWEMSIKVALGKLPLPEPVDSYISSRMVQLGARSLDISVNHAL
KAAALPLHHRDPFDRMLIAQAQLENITIVTADHMFSQYQDVSILWAANL
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|