Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 3427699..3428323 Replicon chromosome
Accession NZ_CP097329
Organism Pseudanabaena mucicola str. Chao 1806

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag M4D78_RS16545 Protein ID WP_286392150.1
Coordinates 3427699..3428097 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag M4D78_RS16550 Protein ID WP_286392152.1
Coordinates 3428099..3428323 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M4D78_RS16510 3423951..3425828 - 1878 WP_286392142.1 excinuclease ABC subunit UvrC -
M4D78_RS16515 3425941..3426063 - 123 WP_286392144.1 hypothetical protein -
M4D78_RS16520 3426270..3426419 - 150 WP_286396900.1 hypothetical protein -
M4D78_RS16525 3426432..3426611 - 180 Protein_3248 DUF5615 family PIN-like protein -
M4D78_RS16530 3426613..3426939 - 327 WP_286392146.1 DUF433 domain-containing protein -
M4D78_RS16535 3427050..3427268 - 219 WP_169363815.1 hypothetical protein -
M4D78_RS16540 3427261..3427584 - 324 WP_286392148.1 DUF4258 domain-containing protein -
M4D78_RS16545 3427699..3428097 - 399 WP_286392150.1 type II toxin-antitoxin system VapC family toxin Toxin
M4D78_RS16550 3428099..3428323 - 225 WP_286392152.1 DUF2281 domain-containing protein Antitoxin
M4D78_RS16555 3428452..3428793 - 342 WP_286392154.1 DUF5615 family PIN-like protein -
M4D78_RS16560 3428795..3429190 - 396 WP_286392156.1 DUF433 domain-containing protein -
M4D78_RS16565 3429242..3429505 - 264 WP_286392158.1 Txe/YoeB family addiction module toxin -
M4D78_RS16570 3429486..3429734 - 249 WP_286392160.1 hypothetical protein -
M4D78_RS16575 3429882..3430121 - 240 WP_286392162.1 YgiT-type zinc finger protein -
M4D78_RS16580 3430253..3431869 - 1617 WP_286392164.1 ATP-binding protein -
M4D78_RS16585 3432061..3432405 - 345 WP_286392166.1 hypothetical protein -
M4D78_RS16590 3432632..3433081 - 450 WP_286392168.1 PIN domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-131)

Antitoxin

Domain of unknown function DUF2281

(7-73)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15381.94 Da        Isoelectric Point: 6.7243

>T245167 WP_286392150.1 NZ_CP097329:c3428097-3427699 [Pseudanabaena mucicola str. Chao 1806]
MKYILDTHLILWYLSEDPNLSTKAKAIVDARNGLHFSIISLWEIYIKINIGKLQINRPIEALPIELQYMNIQILPITIRD
IEIYSSLPLPNTPIKHRDPFDRILIAQAINYSFNLVSKDTAFDSYPVSRIWD

Download         Length: 399 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8683.79 Da        Isoelectric Point: 4.0082

>AT245167 WP_286392152.1 NZ_CP097329:c3428323-3428099 [Pseudanabaena mucicola str. Chao 1806]
MNTDTALWQVVINMPDTLKTELLHYAEYLLNKYPIAKTVEEQPIKQQHGYGSWAGQIFMSSDFDEPLEELEEYM

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References