Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3427699..3428323 | Replicon | chromosome |
| Accession | NZ_CP097329 | ||
| Organism | Pseudanabaena mucicola str. Chao 1806 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M4D78_RS16545 | Protein ID | WP_286392150.1 |
| Coordinates | 3427699..3428097 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M4D78_RS16550 | Protein ID | WP_286392152.1 |
| Coordinates | 3428099..3428323 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M4D78_RS16510 | 3423951..3425828 | - | 1878 | WP_286392142.1 | excinuclease ABC subunit UvrC | - |
| M4D78_RS16515 | 3425941..3426063 | - | 123 | WP_286392144.1 | hypothetical protein | - |
| M4D78_RS16520 | 3426270..3426419 | - | 150 | WP_286396900.1 | hypothetical protein | - |
| M4D78_RS16525 | 3426432..3426611 | - | 180 | Protein_3248 | DUF5615 family PIN-like protein | - |
| M4D78_RS16530 | 3426613..3426939 | - | 327 | WP_286392146.1 | DUF433 domain-containing protein | - |
| M4D78_RS16535 | 3427050..3427268 | - | 219 | WP_169363815.1 | hypothetical protein | - |
| M4D78_RS16540 | 3427261..3427584 | - | 324 | WP_286392148.1 | DUF4258 domain-containing protein | - |
| M4D78_RS16545 | 3427699..3428097 | - | 399 | WP_286392150.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M4D78_RS16550 | 3428099..3428323 | - | 225 | WP_286392152.1 | DUF2281 domain-containing protein | Antitoxin |
| M4D78_RS16555 | 3428452..3428793 | - | 342 | WP_286392154.1 | DUF5615 family PIN-like protein | - |
| M4D78_RS16560 | 3428795..3429190 | - | 396 | WP_286392156.1 | DUF433 domain-containing protein | - |
| M4D78_RS16565 | 3429242..3429505 | - | 264 | WP_286392158.1 | Txe/YoeB family addiction module toxin | - |
| M4D78_RS16570 | 3429486..3429734 | - | 249 | WP_286392160.1 | hypothetical protein | - |
| M4D78_RS16575 | 3429882..3430121 | - | 240 | WP_286392162.1 | YgiT-type zinc finger protein | - |
| M4D78_RS16580 | 3430253..3431869 | - | 1617 | WP_286392164.1 | ATP-binding protein | - |
| M4D78_RS16585 | 3432061..3432405 | - | 345 | WP_286392166.1 | hypothetical protein | - |
| M4D78_RS16590 | 3432632..3433081 | - | 450 | WP_286392168.1 | PIN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15381.94 Da Isoelectric Point: 6.7243
>T245167 WP_286392150.1 NZ_CP097329:c3428097-3427699 [Pseudanabaena mucicola str. Chao 1806]
MKYILDTHLILWYLSEDPNLSTKAKAIVDARNGLHFSIISLWEIYIKINIGKLQINRPIEALPIELQYMNIQILPITIRD
IEIYSSLPLPNTPIKHRDPFDRILIAQAINYSFNLVSKDTAFDSYPVSRIWD
MKYILDTHLILWYLSEDPNLSTKAKAIVDARNGLHFSIISLWEIYIKINIGKLQINRPIEALPIELQYMNIQILPITIRD
IEIYSSLPLPNTPIKHRDPFDRILIAQAINYSFNLVSKDTAFDSYPVSRIWD
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|