Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-YefM |
Location | 3057005..3057507 | Replicon | chromosome |
Accession | NZ_CP097329 | ||
Organism | Pseudanabaena mucicola str. Chao 1806 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M4D78_RS14790 | Protein ID | WP_286391580.1 |
Coordinates | 3057253..3057507 (+) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M4D78_RS14785 | Protein ID | WP_126388797.1 |
Coordinates | 3057005..3057256 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4D78_RS14750 | 3052489..3053373 | + | 885 | WP_286391562.1 | MBL fold metallo-hydrolase | - |
M4D78_RS14755 | 3053540..3054667 | + | 1128 | WP_286391565.1 | type III polyketide synthase | - |
M4D78_RS14760 | 3054719..3055465 | + | 747 | WP_286391568.1 | methyltransferase domain-containing protein | - |
M4D78_RS14765 | 3055423..3055686 | - | 264 | WP_286391570.1 | hypothetical protein | - |
M4D78_RS14770 | 3055655..3055999 | - | 345 | WP_286391572.1 | hypothetical protein | - |
M4D78_RS14775 | 3056105..3056599 | + | 495 | WP_286391574.1 | restriction endonuclease | - |
M4D78_RS14780 | 3056620..3056817 | - | 198 | WP_286391577.1 | hypothetical protein | - |
M4D78_RS14785 | 3057005..3057256 | + | 252 | WP_126388797.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
M4D78_RS14790 | 3057253..3057507 | + | 255 | WP_286391580.1 | Txe/YoeB family addiction module toxin | Toxin |
M4D78_RS14795 | 3057516..3058676 | + | 1161 | WP_286391583.1 | NAD(P)/FAD-dependent oxidoreductase | - |
M4D78_RS14800 | 3058638..3059900 | - | 1263 | WP_286391586.1 | MFS transporter | - |
M4D78_RS14805 | 3060010..3060675 | - | 666 | WP_286391588.1 | pentapeptide repeat-containing protein | - |
M4D78_RS14810 | 3060791..3061519 | + | 729 | WP_286391591.1 | hypothetical protein | - |
M4D78_RS14815 | 3061701..3062087 | + | 387 | WP_286391594.1 | glycine cleavage system protein GcvH | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10193.69 Da Isoelectric Point: 9.5602
>T245166 WP_286391580.1 NZ_CP097329:3057253-3057507 [Pseudanabaena mucicola str. Chao 1806]
VKLIFSERAWEDYLYWQKTDKKILNRINSLIKDIQRDPYSGIGKPEALKHGLSGYWSRRIDDEHRILYKVEDNALLLVQI
RYHY
VKLIFSERAWEDYLYWQKTDKKILNRINSLIKDIQRDPYSGIGKPEALKHGLSGYWSRRIDDEHRILYKVEDNALLLVQI
RYHY
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|