Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TacT2-ataR/DUF1778(antitoxin) |
Location | 2699785..2700581 | Replicon | chromosome |
Accession | NZ_CP097329 | ||
Organism | Pseudanabaena mucicola str. Chao 1806 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | M4D78_RS13050 | Protein ID | WP_286390830.1 |
Coordinates | 2699785..2700288 (-) | Length | 168 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | M4D78_RS13055 | Protein ID | WP_286390832.1 |
Coordinates | 2700285..2700581 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4D78_RS13010 | 2694904..2695164 | - | 261 | WP_286390812.1 | hypothetical protein | - |
M4D78_RS13015 | 2695161..2695391 | - | 231 | WP_286390813.1 | hypothetical protein | - |
M4D78_RS13020 | 2695409..2695537 | - | 129 | WP_286390816.1 | DUF433 domain-containing protein | - |
M4D78_RS13025 | 2695599..2695796 | - | 198 | WP_286390819.1 | hypothetical protein | - |
M4D78_RS13030 | 2695846..2697042 | - | 1197 | WP_286390821.1 | hypothetical protein | - |
M4D78_RS13035 | 2697074..2697277 | - | 204 | WP_286390824.1 | DUF2281 domain-containing protein | - |
M4D78_RS13040 | 2697292..2699172 | - | 1881 | WP_286390826.1 | N-6 DNA methylase | - |
M4D78_RS13045 | 2699206..2699676 | - | 471 | WP_286390828.1 | DUF29 domain-containing protein | - |
M4D78_RS13050 | 2699785..2700288 | - | 504 | WP_286390830.1 | GNAT family N-acetyltransferase | Toxin |
M4D78_RS13055 | 2700285..2700581 | - | 297 | WP_286390832.1 | DUF1778 domain-containing protein | Antitoxin |
M4D78_RS13060 | 2700818..2701426 | + | 609 | WP_286390835.1 | hypothetical protein | - |
M4D78_RS13065 | 2701668..2704700 | - | 3033 | WP_286390837.1 | L-glutamate gamma-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 168 a.a. Molecular weight: 18480.48 Da Isoelectric Point: 9.1718
>T245165 WP_286390830.1 NZ_CP097329:c2700288-2699785 [Pseudanabaena mucicola str. Chao 1806]
MSLDNLRSPEKLNLSHQIKGFDSGNSQLDDWLKNRAIKNEIEGASRTYVLCNGDVVIGFYCLANGSVFQSVATGKVRRNM
PDPIPVMVIGRLAIDRSWQGKGLGRALLKDAILRTLQASEIAGIRAILVHAISENAKLFYEKCGFTVSPIDEMTLMIRIK
DAITVFQ
MSLDNLRSPEKLNLSHQIKGFDSGNSQLDDWLKNRAIKNEIEGASRTYVLCNGDVVIGFYCLANGSVFQSVATGKVRRNM
PDPIPVMVIGRLAIDRSWQGKGLGRALLKDAILRTLQASEIAGIRAILVHAISENAKLFYEKCGFTVSPIDEMTLMIRIK
DAITVFQ
Download Length: 504 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|