Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /BrnT(toxin) |
Location | 2363320..2363806 | Replicon | chromosome |
Accession | NZ_CP097329 | ||
Organism | Pseudanabaena mucicola str. Chao 1806 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | M4D78_RS11500 | Protein ID | WP_286390209.1 |
Coordinates | 2363320..2363583 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | M4D78_RS11505 | Protein ID | WP_286390211.1 |
Coordinates | 2363573..2363806 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M4D78_RS11490 | 2361668..2361817 | + | 150 | WP_286390207.1 | hypothetical protein | - |
M4D78_RS11495 | 2362697..2363242 | - | 546 | Protein_2258 | transposase | - |
M4D78_RS11500 | 2363320..2363583 | + | 264 | WP_286390209.1 | BrnT family toxin | Toxin |
M4D78_RS11505 | 2363573..2363806 | + | 234 | WP_286390211.1 | CopG family transcriptional regulator | Antitoxin |
M4D78_RS11510 | 2364123..2364959 | - | 837 | WP_286390213.1 | TPM domain-containing protein | - |
M4D78_RS11515 | 2365059..2365898 | + | 840 | WP_286390215.1 | ribosome biogenesis GTPase YlqF | - |
M4D78_RS11520 | 2365981..2366907 | + | 927 | WP_286390217.1 | ribonuclease HI | - |
M4D78_RS11525 | 2366973..2367386 | + | 414 | WP_286390219.1 | element excision factor XisH family protein | - |
M4D78_RS11530 | 2367374..2367718 | + | 345 | WP_286390222.1 | XisI protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10469.79 Da Isoelectric Point: 8.4753
>T245164 WP_286390209.1 NZ_CP097329:2363320-2363583 [Pseudanabaena mucicola str. Chao 1806]
MRNFEYDEDKSQSNFAKHGIDFVEAQKLWNDPNLLEIPSRIQDEPRFVVIGKINSKHWSGVITYRDQNIRIIYVRRSRTQ
EVALYER
MRNFEYDEDKSQSNFAKHGIDFVEAQKLWNDPNLLEIPSRIQDEPRFVVIGKINSKHWSGVITYRDQNIRIIYVRRSRTQ
EVALYER
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|