Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2610634..2611291 | Replicon | chromosome |
Accession | NZ_CP097327 | ||
Organism | Providencia vermicola strain P13 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | M5J11_RS11850 | Protein ID | WP_163860914.1 |
Coordinates | 2610881..2611291 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | M5J11_RS11845 | Protein ID | WP_154624313.1 |
Coordinates | 2610634..2610900 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5J11_RS11830 (M5J11_11830) | 2605786..2608662 | + | 2877 | WP_251463864.1 | aminomethyl-transferring glycine dehydrogenase | - |
M5J11_RS11835 (M5J11_11835) | 2608759..2609379 | - | 621 | WP_154624315.1 | HD domain-containing protein | - |
M5J11_RS11840 (M5J11_11840) | 2609391..2610380 | - | 990 | WP_154624314.1 | tRNA-modifying protein YgfZ | - |
M5J11_RS11845 (M5J11_11845) | 2610634..2610900 | + | 267 | WP_154624313.1 | FAD assembly factor SdhE | Antitoxin |
M5J11_RS11850 (M5J11_11850) | 2610881..2611291 | + | 411 | WP_163860914.1 | protein YgfX | Toxin |
M5J11_RS11855 (M5J11_11855) | 2611336..2611854 | - | 519 | WP_154624312.1 | flavodoxin FldB | - |
M5J11_RS11860 (M5J11_11860) | 2611939..2612862 | + | 924 | WP_154624329.1 | site-specific tyrosine recombinase XerD | - |
M5J11_RS11865 (M5J11_11865) | 2612882..2613583 | + | 702 | WP_154624311.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5J11_RS11870 (M5J11_11870) | 2613593..2615326 | + | 1734 | WP_196713356.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15375.24 Da Isoelectric Point: 10.8779
>T245159 WP_163860914.1 NZ_CP097327:2610881-2611291 [Providencia vermicola]
VVLWKSNLSISWKTQLFSTCAHGLVGFILLVAPWAPGNSMVWLPLLAIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWNIIKQPWCSRVGILLTLSALQGKQQKIRLWIAKDALSEESWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCAHGLVGFILLVAPWAPGNSMVWLPLLAIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWNIIKQPWCSRVGILLTLSALQGKQQKIRLWIAKDALSEESWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|